Complement Factor B Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-89985
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Cited:
Mouse, Rat
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence
Cited:
Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen, Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KDNEQHVFKVKDMENLEDVFYQMIDESQSLSLCGMVWEHRKGTDYHKQPWQAKISVIRPSKGHESCMGAVVSEYFVLTAAHCFTVDDKEHSIKVSVGGEKRDLEIEVVLFHPNYNINGKKEAGIPEFYDYDVALIKLKNKLKYG
Reactivity Notes
Mouse (86%), (81%)
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Complement Factor B Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: Complement Factor B Antibody - BSA Free [NBP1-89985]
Staining of human cell line ASC TERT1 shows localization to endoplasmic reticulum.Immunohistochemistry-Paraffin: Complement Factor B Antibody [NBP1-89985]
Immunohistochemistry-Paraffin: Complement Factor B Antibody [NBP1-89985] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.Immunohistochemistry-Paraffin: Complement Factor B Antibody - BSA Free [NBP1-89985]
Staining of human placenta shows strong positivity in trophoblastic cells.Immunohistochemistry-Paraffin: Complement Factor B Antibody - BSA Free [NBP1-89985]
Staining of human testis shows moderate cytoplasmic positivity in Leydig cells.Immunohistochemistry-Paraffin: Complement Factor B Antibody - BSA Free [NBP1-89985]
Staining of human kidney shows moderate positivity in secretion surrounding cells in tubules.Immunocytochemistry/ Immunofluorescence: Complement Factor B Antibody - BSA Free [NBP1-89985] -
The activation of mTORC1 in KCs enhances complement alternative system.a Expression heatmap of genes of neutrophils chemotaxis or complement activation analyzed by RNA-seq from Tsc1+/+ and Tsc1-/- BMMs (n = 3 each). b Western blotting result was shown the expression of CFB protein in hepatic tissues from mice. c Left, representative co-immunofluorescent staining images for F4/80 with CFB. Scale bar = 50 μm. Right, quantitative determination of F4/80+ and CFB+ cells among groups as indicated, n = 3. d Western blotting assay showing the abundance for TSC1, CFB, and p-S6 in BMMs. e qRT-PCR analysis showing the CFB mRNA abundance in BMMs, n = 3. f Western blotting assay showing the abundance for TSC1, CFB, and p-S6 in KCs. g qRT-PCR analysis showing the CFB mRNA abundance in KCs, n = 3. h Representative immunofluorescent staining images for C3d. Scale bar = 50 μm. i Representative immunostaining images for C5b-9. Scale bar = 50 μm. j Western blotting assay showing the abundance for Rheb and CFB in BMMs. k Western blotting assay showing the abundance for Rheb and CFB in KCs. l Representative co-immunofluorescent staining images for F4/80 with CFB (white arrows). Scale bar = 100 μm. m Quantitative determination of F4/80+ and CFB+ cells among groups as indicated, n = 3. n Representative immunofluorescent staining images for C3d. Scale bar = 100 μm. o Representative immunostaining images for C5b-9 among groups as indicated. Scale bar = 100 μm. *p < 0.05. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36494334), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Immunocytochemistry/ Immunofluorescence: Complement Factor B Antibody - BSA Free [NBP1-89985] -
The activation of mTORC1 in KCs enhances complement alternative system.a Expression heatmap of genes of neutrophils chemotaxis or complement activation analyzed by RNA-seq from Tsc1+/+ and Tsc1-/- BMMs (n = 3 each). b Western blotting result was shown the expression of CFB protein in hepatic tissues from mice. c Left, representative co-immunofluorescent staining images for F4/80 with CFB. Scale bar = 50 μm. Right, quantitative determination of F4/80+ and CFB+ cells among groups as indicated, n = 3. d Western blotting assay showing the abundance for TSC1, CFB, and p-S6 in BMMs. e qRT-PCR analysis showing the CFB mRNA abundance in BMMs, n = 3. f Western blotting assay showing the abundance for TSC1, CFB, and p-S6 in KCs. g qRT-PCR analysis showing the CFB mRNA abundance in KCs, n = 3. h Representative immunofluorescent staining images for C3d. Scale bar = 50 μm. i Representative immunostaining images for C5b-9. Scale bar = 50 μm. j Western blotting assay showing the abundance for Rheb and CFB in BMMs. k Western blotting assay showing the abundance for Rheb and CFB in KCs. l Representative co-immunofluorescent staining images for F4/80 with CFB (white arrows). Scale bar = 100 μm. m Quantitative determination of F4/80+ and CFB+ cells among groups as indicated, n = 3. n Representative immunofluorescent staining images for C3d. Scale bar = 100 μm. o Representative immunostaining images for C5b-9 among groups as indicated. Scale bar = 100 μm. *p < 0.05. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36494334), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Immunocytochemistry/ Immunofluorescence: Complement Factor B Antibody - BSA Free [NBP1-89985] -
Down regulation of CFB in liver protects against Con-A induced liver injury.a Western blotting assay showing CFB expression in mouse livers after shRNA-CFB injection. b Representative co-immunofluorescent staining images for F4/80 with CFB (white arrows). Scale bar = 100 μm. c The strategy for establishing a mouse model of injection of shRNA-CFB and Con-A administration. d The ALT levels in serum of mice exposed to Con-A for 8 h, n = 6. e Representative HE-stained mouse livers. Scale bar = 100 μm. f Liver sections of were immunofluorescent stained with TUNEL. Scale bar = 200 μm. g Left, representative immunofluorescent staining images for ly6b. Scale bar = 100 μm. Right, quantitative determination of ly6b+ cells among groups as indicated, n = 4. h Left, representative immunofluorescent staining images for C3d. Scale bar = 100 μm. Right, quantitative determination of C3d area in a field of vision, n = 4. i Representative immunostaining images for C5b-9. Scale bar = 100 μm. j Left, representative immunofluorescent staining images for F4/80 (white arrows). Scale bar = 100 μm. Right, quantitative determination of F4/80+ cells among groups as indicated, n = 4. *p < 0.05. k Schematic working model on the role of mTORC1 activation in hepatocytes and KCs in the pathogenesis of ALD. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36494334), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for Complement Factor B Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:200 - 1:500
Immunohistochemistry-Paraffin
1:200 - 1:500
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation/Permeabilization: PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Complement Factor B
Alternate Names
BF, BFD, C3/C5 convertase, CFAB, CFB, GBG, H2-Bf, PBF2
Gene Symbol
CFB
Additional Complement Factor B Products
Product Documents for Complement Factor B Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Complement Factor B Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for Complement Factor B Antibody - BSA Free
Customer Reviews for Complement Factor B Antibody - BSA Free
There are currently no reviews for this product. Be the first to review Complement Factor B Antibody - BSA Free and earn rewards!
Have you used Complement Factor B Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...