COQ5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-13859

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse

Predicted:

Rat (94%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all COQ5 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: PGGRFLCLEFSQVNNPLISRLYDLYSFQVIPVLGEVIAGDWKSYQYLVESIRRFPSQEEFKDMIEDAGFHKVTYESLTSGIVAIHSGFKL

Reactivity Notes

Mouse reactivity reported in a verified customer review.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for COQ5 Antibody - BSA Free

Western Blot: COQ5 Antibody [NBP2-13859]

Western Blot: COQ5 Antibody [NBP2-13859]

Western Blot: COQ5 Antibody [NBP2-13859] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: COQ5 Antibody [NBP2-13859]

Immunohistochemistry-Paraffin: COQ5 Antibody [NBP2-13859]

Immunohistochemistry-Paraffin: COQ5 Antibody [NBP2-13859] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
COQ5 Antibody

Western Blot: Rabbit Polyclonal COQ5 Antibody [NBP2-13859]

Western Blot: Rabbit Polyclonal COQ5 Antibody [NBP2-13859] - Tested in a mouse model with involvement of a COQ5-related protein - right lane. A decay in protein levels is observed at the expected MW vs the WT sibling - left lane. Blocking BSA 5%. 1º Ab: 1:750. 2º Ab: 1:2000. Image from a verified customer review.

Applications for COQ5 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reviewed Applications

Read 1 review rated 5 using NBP2-13859 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: COQ5

Converts DDMQH2 into DMQH2

Alternate Names

coenzyme Q5 homolog, methyltransferase (S. cerevisiae), coenzyme Q5 homolog, methyltransferase (yeast), EC 2.1.1, EC 2.1.1.-, EC 2.1.1.52, MGC104303, MGC4767, ubiquinone biosynthesis methyltransferase COQ5, mitochondrial

Gene Symbol

COQ5

Additional COQ5 Products

Product Documents for COQ5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for COQ5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for COQ5 Antibody - BSA Free (1)

5 out of 5
1 Customer Rating
5 Stars
100%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used COQ5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 1 的 1 review Showing All
Filter By:
Clear Filters X
  • COQ5 Antibody
    Name: Luis Carlos López García
    Application: Western Blot
    Sample Tested: kidney
    Species: Mouse
    Verified Customer | Posted 07/24/2024
    Tested in a mouse model with involvement of a COQ5-related protein - right lane. A decay in protein levels is observed at the expected MW vs the WT sibling - left lane. Blocking BSA 5%. 1º Ab: 1:750. 2º Ab: 1:2000.
    COQ5 Antibody - BSA Free NBP2-13859
    Bio-Techne Response
    This review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.

There are no reviews that match your criteria.

Showing  1 - 1 的 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies