CPT1B Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59576

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Rat

Cited:

Human, Mouse, Rat

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to CPT1B(carnitine palmitoyltransferase 1B (muscle)) The peptide sequence was selected from the middle region of CPT1B. Peptide sequence DLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAA. The peptide sequence for this immunogen was taken from within the described region.

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 31013835).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

88 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for CPT1B Antibody - BSA Free

Western Blot: CPT1B Antibody [NBP1-59576]

Western Blot: CPT1B Antibody [NBP1-59576]

Western Blot: CPT1B Antibody [NBP1-59576] - Sample Type : 1: 45ug human capan1 cell lysate Primary Antibody Dilution : 1:1000 Secondary Antibody : Anti-rabbit HRP Secondary Antibody Dilution : 1:5000 Color
Immunohistochemistry: CPT1B Antibody [NBP1-59576]

Immunohistochemistry: CPT1B Antibody [NBP1-59576]

Immunohistochemistry: CPT1B Antibody [NBP1-59576] - searcher: Dr. Pankaj Kumar Singh, UNMC, Omaha, NE Application: IHC Species+tissue/cell type:Species+tissue/cell type: Human Capan1 cells Primary antibody dilution: 1:300 Secondary antibody: Anti-rabbit Alexa Fluor 488 Secondary antibody dilution:1:200
Western Blot: CPT1B Antibody [NBP1-59576]

Western Blot: CPT1B Antibody [NBP1-59576]

Western Blot: CPT1B Antibody [NBP1-59576] - Titration: 0.2-1 ug/ml, Positive Control: HT1080 cell lysate.
Western Blot: CPT1B Antibody [NBP1-59576]

Western Blot: CPT1B Antibody [NBP1-59576]

Western Blot: CPT1B Antibody [NBP1-59576] - Sample Tissue: Human 293T Antibody Dilution: 1.0 ug/ml
CPT1B Antibody - BSA Free

Western Blot: CPT1B Antibody - BSA Free [NBP1-59576] -

The effect of HFD and HFD+FO consumption on mitochondrial channeling of fatty acids. Panel A presents a total acyl-carnitine (A-CAR) content in rat VAT and SAT, respectively. Panel B and D show the content of A-CAR individual molecular species. Panel C and D present VAT and SAT protein expression of carnitine palmitoyltransferase 1 B (CPT1 B). Values are expressed as mean +/- standard deviation. a p < 0.05; b p < 0.01; c p < 0.001—as compared to SD group. # p < 0.01; ^ p < 0.001—as compared to HFD group, n = 8 per group. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/31013835), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
CPT1B Antibody - BSA Free

Western Blot: CPT1B Antibody - BSA Free [NBP1-59576] -

The effect of HFD and HFD+FO consumption on mitochondrial channeling of fatty acids. Panel A presents a total acyl-carnitine (A-CAR) content in rat VAT and SAT, respectively. Panel B and D show the content of A-CAR individual molecular species. Panel C and D present VAT and SAT protein expression of carnitine palmitoyltransferase 1 B (CPT1 B). Values are expressed as mean +/- standard deviation. a p < 0.05; b p < 0.01; c p < 0.001—as compared to SD group. # p < 0.01; ^ p < 0.001—as compared to HFD group, n = 8 per group. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/31013835), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
CPT1B Antibody - BSA Free

Western Blot: CPT1B Antibody - BSA Free [NBP1-59576] -

CCM treatment regulates the key fatty acid metabolism factors in rabbits with HF. (a) Western blot analysis of the expressions of CD36, CPT-1, and ADAM. Densitometric analysis is shown in the bar graph. (b) Western blot analysis of the expression of ACC. Densitometric analysis is shown in the bar graph. Data are expressed as mean values +/- SD (*P < 0.05 compared with the sham group; #P < 0.05 compared with HF group). Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35799598), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for CPT1B Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:300

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CPT1B

The protein encoded by this gene, a member of the carnitine/choline acetyltransferase family, is the rate-controlling enzyme of the long-chain fatty acid beta-oxidation pathway in muscle mitochondria. This enzyme is required for the net transport of long-

Long Name

Carnitine O-palmitoyltransferase 1, muscle isoform

Alternate Names

CPT1-M, CPTI-M, KIAA1670

Entrez Gene IDs

1375 (Human)

Gene Symbol

CPT1B

UniProt

Additional CPT1B Products

Product Documents for CPT1B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CPT1B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for CPT1B Antibody - BSA Free

Customer Reviews for CPT1B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CPT1B Antibody - BSA Free and earn rewards!

Have you used CPT1B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...