Creatine Kinase BB Antibody (1G10U9)

Novus Biologicals | Catalog # NBP3-16510

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 1G10U9 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Creatine Kinase BB (NP_001814.2). MPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGY

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Creatine Kinase BB Antibody (1G10U9)

Western Blot: Creatine Kinase BB Antibody (1G10U9) [NBP3-16510]

Western Blot: Creatine Kinase BB Antibody (1G10U9) [NBP3-16510]

Western Blot: Creatine Kinase BB Antibody (1G10U9) [NBP3-16510] - Western blot analysis of extracts of various cell lines, using Creatine Kinase BB Rabbit mAb (NBP3-16510) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.
Immunohistochemistry-Paraffin: Creatine Kinase BB Antibody (1G10U9) [NBP3-16510]

Immunohistochemistry-Paraffin: Creatine Kinase BB Antibody (1G10U9) [NBP3-16510]

Immunohistochemistry-Paraffin: Creatine Kinase BB Antibody (1G10U9) [NBP3-16510] - Immunohistochemistry of paraffin-embedded human appendix using Creatine Kinase BB Rabbit mAb (NBP3-16510) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: Creatine Kinase BB Antibody (1G10U9) [NBP3-16510]

Immunohistochemistry-Paraffin: Creatine Kinase BB Antibody (1G10U9) [NBP3-16510]

Immunohistochemistry-Paraffin: Creatine Kinase BB Antibody (1G10U9) [NBP3-16510] - Immunohistochemistry of paraffin-embedded rat heart using Creatine Kinase BB Rabbit mAb (NBP3-16510) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Applications for Creatine Kinase BB Antibody (1G10U9)

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Product Documents for Creatine Kinase BB Antibody (1G10U9)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Creatine Kinase BB Antibody (1G10U9)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Creatine Kinase BB Antibody (1G10U9)

There are currently no reviews for this product. Be the first to review Creatine Kinase BB Antibody (1G10U9) and earn rewards!

Have you used Creatine Kinase BB Antibody (1G10U9)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...