CRY1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-69080

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Amphibian

Cited:

Syrian Hamster

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen, Western Blot, Simple Western

Cited:

Immunohistochemistry-Frozen, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CRY1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to CRY1 (cryptochrome 1, photolyase-like). The peptide sequence was selected from the N terminal of CRY1 (NP_004066). Peptide sequence KRFQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEKYGVPSLEELGF. The peptide sequence for this immunogen was taken from within the described region.

Reactivity Notes

Amphibian reactivity reported in a verified customer review.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

64 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for CRY1 Antibody - BSA Free

Western Blot: CRY1 Antibody [NBP1-69080]

Western Blot: CRY1 Antibody [NBP1-69080]

Western Blot: CRY1 Antibody [NBP1-69080] - Sample Tissue: Hela Whole cell, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5ug/ml, Lysate Quantity: 25ug/lane, Gel Concentration: 0.12%
Immunohistochemistry-Paraffin: CRY1 Antibody [NBP1-69080]

Immunohistochemistry-Paraffin: CRY1 Antibody [NBP1-69080]

Immunohistochemistry-Paraffin: CRY1 Antibody [NBP1-69080] - Human testis tissue at an antibody concentration of 5ug/ml.
Western Blot: CRY1 Antibody [NBP1-69080]

Western Blot: CRY1 Antibody [NBP1-69080]

Western Blot: CRY1 Antibody [NBP1-69080] - Sample Tissue:Hela Whole cell. Lane A: Primary Antibody Lane B: Primary Antibody + Blocking.
CRY1 Antibody

Immunohistochemistry-Frozen: Rabbit Polyclonal CRY1 Antibody [NBP1-69080] -

Immunohistochemistry-Frozen: Rabbit Polyclonal CRY1 Antibody [NBP1-69080] - DAB staining in SCN of green treefrog, 10X. Primary antibody dilution - 1:1000. Image from a verified customer review.

Applications for CRY1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Frozen

Validated for Immunohistochemistry-Frozen from a verified customer review.

Immunohistochemistry-Paraffin

5 ug/ml

Simple Western

1:50

Western Blot

1.0 ug/ml
Application Notes

See Simple Western Antibody Database for Simple Western validation: HeLa lysate at 0.5 mg/ml as sample; separated by size; antibody dilution of 1:50; observed molecular weight was 61 kDa;matrix was 12-230 kDa; detected by Chemiluminescence.

Reviewed Applications

Read 1 review rated 4 using NBP1-69080 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CRY1

CRY1 is the blue light-dependent regulator of the circadian feedback loop. 'CRY1 inhibits CLOCK|NPAS2-ARNTL E box-mediated transcription.'CRY1 acts, in conjunction with CRY2, in maintaining period length and circadian rhythmicity. 'CRY1 has no photolyase activity. 'CRY1 is capable of translocating circadian clock core proteins such as PER proteins to the nucleus. 'CRY1 may inhibit CLOCK|NPAS2-ARNTL transcriptional activity through stabilizing the unphosphorylated form of ARNTL.

Long Name

Cryptochrome 1

Alternate Names

Cryptochrome I, PHLL1

Entrez Gene IDs

1407 (Human)

Gene Symbol

CRY1

UniProt

Q16526

Additional CRY1 Products

Product Documents for CRY1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CRY1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for CRY1 Antibody - BSA Free

Customer Reviews for CRY1 Antibody - BSA Free (1)

4 out of 5
1 Customer Rating
5 Stars
0%
4 Stars
100%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used CRY1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 1 的 1 review Showing All
Filter By:
Clear Filters X
  • CRY1 Antibody
    Name: Deborah Lutterschmidt
    Application: Immunohistochemistry-Frozen
    Sample Tested: Brain
    Species: Hyla cinerea
    Verified Customer | Posted 10/23/2023
    DAB staining in SCN of green treefrog, 10X. Dilution 1:1000 of primary AB.
    CRY1 Antibody - BSA Free NBP1-69080
    Bio-Techne Response
    This review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.

There are no reviews that match your criteria.

Showing  1 - 1 的 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CRY1 Antibody - BSA Free

Showing  1 - 1 的 1 FAQ Showing All

    • Q: I just received some NBP1-69080 anti-CRY antibodies. There are no instructions for dilution. Do I dilute with 100 ul PBS?
      A: Please accept my apologies that you did not receive the appropriate reconstitution instructions with your Cryptochrome I antibody with catalogue number NBP1-69080. Our information for the reconstitution of this product is as follows: Add 50 ul of distilled water. Final anti-CRY1 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Showing  1 - 1 的 1 FAQ Showing All
View all FAQs for Antibodies