Cytochrome b245 alpha Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59573

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Cytochrome b245 alpha Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to CYBA(cytochrome b-245, alpha polypeptide) The peptide sequence was selected from the middle region of CYBA. Peptide sequence TILGTACLAIASGIYLLAAVRGEQWTPIEPKPRERPQIGGTIKQPPSNPP. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Cytochrome b245 alpha Antibody - BSA Free

Western Blot: Cytochrome b245 alpha Antibody [NBP1-59573]

Western Blot: Cytochrome b245 alpha Antibody [NBP1-59573]

Western Blot: Cytochrome b245 alpha Antibody [NBP1-59573] - Titration: 0.2-1 ug/ml, Positive Control: Human Small Intestine.
Immunohistochemistry: Cytochrome b245 alpha Antibody [NBP1-59573]

Immunohistochemistry: Cytochrome b245 alpha Antibody [NBP1-59573]

Immunohistochemistry: Cytochrome b245 alpha Antibody [NBP1-59573] - Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue Observed Staining: Plasma membrane in intercalated disk Primary Antibody Concentration: 1:100 Other Working Concentrations: N/A Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec

Applications for Cytochrome b245 alpha Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Cytochrome b245 alpha

Cytochrome b is comprised of a light chain (alpha) and a heavy chain (beta). This gene encodes the light, alpha subunit which has been proposed as a primary component of the microbicidal oxidase system of phagocytes. Mutations in this gene are associated

Alternate Names

cytochrome b light chain, Cytochrome b(558) alpha chain, cytochrome b(558) alpha-subunit, cytochrome b, alpha polypeptide, cytochrome b-245 light chain, cytochrome b-245, alpha polypeptide, Cytochrome b558 subunit alpha, flavocytochrome b-558 alpha polypeptide, Neutrophil cytochrome b 22 kDa polypeptide, p22 phagocyte B-cytochrome, p22phox, p22-PHOX, Superoxide-generating NADPH oxidase light chain subunit

Gene Symbol

CYBA

UniProt

P13498 (Human)

Additional Cytochrome b245 alpha Products

Product Documents for Cytochrome b245 alpha Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Cytochrome b245 alpha Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Cytochrome b245 alpha Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Cytochrome b245 alpha Antibody - BSA Free and earn rewards!

Have you used Cytochrome b245 alpha Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies