Cytokeratin 13 Antibody (5M6B10)

Novus Biologicals | Catalog # NBP3-15261

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 5M6B10 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Cytokeratin 13 (P13646). LTGNEKITMQNLNDRLASYLEKVRALEEANADLEVKIRDWHLKQSPASPERDYSPYYKTIEELRDKILTATIENNRVILEIDNARLAADDFRLKYENELAL

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Cytokeratin 13 Antibody (5M6B10)

Western Blot: Cytokeratin 13 Antibody (5M6B10) [NBP3-15261]

Western Blot: Cytokeratin 13 Antibody (5M6B10) [NBP3-15261]

Western Blot: Cytokeratin 13 Antibody (5M6B10) [NBP3-15261] - Western blot analysis of extracts of various cell lines, using Cytokeratin 13 (KRT13) Rabbit mAb (NBP3-15261) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Immunocytochemistry/ Immunofluorescence: Cytokeratin 13 Antibody (5M6B10) [NBP3-15261]

Immunocytochemistry/ Immunofluorescence: Cytokeratin 13 Antibody (5M6B10) [NBP3-15261]

Immunocytochemistry/Immunofluorescence: Cytokeratin 13 Antibody (5M6B10) [NBP3-15261] - Immunofluorescence analysis of human cervix cancer using Cytokeratin 13 (KRT13) Rabbit mAb (NBP3-15261) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry: Cytokeratin 13 Antibody (5M6B10) [NBP3-15261]

Immunohistochemistry: Cytokeratin 13 Antibody (5M6B10) [NBP3-15261]

Immunohistochemistry: Cytokeratin 13 Antibody (5M6B10) [NBP3-15261] - Immunofluorescence analysis of mouse bladder using Cytokeratin 13 (KRT13) Rabbit mAb (NBP3-15261) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: Cytokeratin 13 Antibody (5M6B10) [NBP3-15261]

Immunohistochemistry-Paraffin: Cytokeratin 13 Antibody (5M6B10) [NBP3-15261]

Immunohistochemistry-Paraffin: Cytokeratin 13 Antibody (5M6B10) [NBP3-15261] - Immunohistochemistry of paraffin-embedded human lung squamous carcinoma tissue using Cytokeratin 13 (KRT13) Rabbit mAb (NBP3-15261) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry: Cytokeratin 13 Antibody (5M6B10) [NBP3-15261]

Immunohistochemistry: Cytokeratin 13 Antibody (5M6B10) [NBP3-15261]

Immunohistochemistry: Cytokeratin 13 Antibody (5M6B10) [NBP3-15261] - Immunofluorescence analysis of rat bladder using Cytokeratin 13 (KRT13) Rabbit mAb (NBP3-15261) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Cytokeratin 13 Antibody (5M6B10)

Immunohistochemistry: Cytokeratin 13 Antibody (5M6B10) [Cytokeratin 13] -

Immunohistochemistry: Cytokeratin 13 Antibody (5M6B10) [Cytokeratin 13] - Immunohistochemistry analysis of paraffin-embedded Human esophagus tissue using Cytokeratin 13 Rabbit mAb at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Cytokeratin 13 Antibody (5M6B10)

Immunohistochemistry: Cytokeratin 13 Antibody (5M6B10) [Cytokeratin 13] -

Immunohistochemistry: Cytokeratin 13 Antibody (5M6B10) [Cytokeratin 13] - Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using Cytokeratin 13 Rabbit mAb at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Applications for Cytokeratin 13 Antibody (5M6B10)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Cytokeratin 13

Alternate Names

CK13, CK-13, cytokeratin 13, Cytokeratin-13, K13cytokeratin-13, keratin 13, keratin, type I cytoskeletal 13, keratin-13, MGC161462, MGC3781

Gene Symbol

KRT13

Additional Cytokeratin 13 Products

Product Documents for Cytokeratin 13 Antibody (5M6B10)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Cytokeratin 13 Antibody (5M6B10)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Cytokeratin 13 Antibody (5M6B10)

There are currently no reviews for this product. Be the first to review Cytokeratin 13 Antibody (5M6B10) and earn rewards!

Have you used Cytokeratin 13 Antibody (5M6B10)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...