Cytokeratin 15 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-85603

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: RLEQEIATYRSLLEGQDAKMAGIGIREASSGGGGSSSNFHINVEESVDGQVVSSHKREI

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Cytokeratin 15 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Cytokeratin 15 Antibody [NBP1-85603]

Immunocytochemistry/ Immunofluorescence: Cytokeratin 15 Antibody [NBP1-85603]

Immunocytochemistry/Immunofluorescence: Cytokeratin 15 Antibody [NBP1-85603] - Staining of human cell line HaCaT shows localization to intermediate filaments. Antibody staining is shown in green.
Cytokeratin 15 Antibody

Immunocytochemistry/Immunofluorescence: Cytokeratin 15 Antibody [NBP1-85603] -

Immunocytochemistry/Immunofluorescence: Cytokeratin 15 Antibody [NBP1-85603] - Overnight incubation at 4ºC with Keratin 15 antibody diluted 1:400 in PBS/BSA 1%. Green: Cytokeratin 15, Blue: DAPI. Image from verified customer review.
Cytokeratin 15 Antibody - BSA Free Immunohistochemistry-Paraffin: Cytokeratin 15 Antibody - BSA Free [NBP1-85603]

Immunohistochemistry-Paraffin: Cytokeratin 15 Antibody - BSA Free [NBP1-85603]

Staining of human liver shows no positivity in hepatocytes as expected.
Cytokeratin 15 Antibody - BSA Free Immunohistochemistry-Paraffin: Cytokeratin 15 Antibody - BSA Free [NBP1-85603]

Immunohistochemistry-Paraffin: Cytokeratin 15 Antibody - BSA Free [NBP1-85603]

Staining of human prostate shows strong membranous positivity in glandular cells.
Cytokeratin 15 Antibody - BSA Free Immunohistochemistry-Paraffin: Cytokeratin 15 Antibody - BSA Free [NBP1-85603]

Immunohistochemistry-Paraffin: Cytokeratin 15 Antibody - BSA Free [NBP1-85603]

Staining of human skin shows strong membranous/cytoplasmic positivity in squamous epithelial cells.
Cytokeratin 15 Antibody - BSA Free Immunohistochemistry-Paraffin: Cytokeratin 15 Antibody - BSA Free [NBP1-85603]

Immunohistochemistry-Paraffin: Cytokeratin 15 Antibody - BSA Free [NBP1-85603]

Staining of human skeletal muscle shows no positivity in myocytes as expected.
Cytokeratin 15 Antibody - BSA Free Western Blot: Cytokeratin 15 Antibody - BSA Free [NBP1-85603]

Western Blot: Cytokeratin 15 Antibody - BSA Free [NBP1-85603]

Analysis in human cell lines A-431 and HEK293 using Anti-KRT15 antibody. Corresponding KRT15 RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Cytokeratin 15 Antibody - BSA Free Immunohistochemistry-Paraffin: Cytokeratin 15 Antibody - BSA Free [NBP1-85603]

Immunohistochemistry-Paraffin: Cytokeratin 15 Antibody - BSA Free [NBP1-85603]

Immunohistochemistry analysis in human esophagus and liver tissues using HPA023910 antibody. Corresponding KRT15 RNA-seq data are presented for the same tissues.
Cytokeratin 15 Antibody - BSA Free Immunohistochemistry-Paraffin: Cytokeratin 15 Antibody - BSA Free [NBP1-85603]

Immunohistochemistry-Paraffin: Cytokeratin 15 Antibody - BSA Free [NBP1-85603]

Staining of human esophagus shows strong membranous/cytoplasmic positivity in squamous epithelial cells.

Applications for Cytokeratin 15 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100.

Reviewed Applications

Read 1 review rated 4 using NBP1-85603 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Cytokeratin 15

Long Name

keratin 15

Alternate Names

CK15, CK-15, cytokeratin 15, cytokeratin-15, K15, K15keratin-15, basic, K1CO, keratin 15, keratin, type I cytoskeletal 15, Keratin-15, keratin-15, beta, KRTB, type I cytoskeletal 15

Gene Symbol

KRT15

Additional Cytokeratin 15 Products

Product Documents for Cytokeratin 15 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Cytokeratin 15 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Cytokeratin 15 Antibody - BSA Free (1)

4 out of 5
1 Customer Rating
5 Stars
0%
4 Stars
100%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used Cytokeratin 15 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 11 review Showing All
Filter By:
  • Cytokeratin 15 Antibody
    Name: Patricia Carulla Martí
    Application: Immunocytochemistry
    Sample Tested: Cultured Human Keratinocytes
    Species: Human
    Verified Customer | Posted 06/13/2023
    Overnight incubation at 4ºC with Keratin 15 antibody diluted 1:400 in PBS/BSA 1% Green: Cytokeratin 15 Blue: DAPI
    Cytokeratin 15 Antibody - BSA Free NBP1-85603

There are no reviews that match your criteria.

Showing  1 - 11 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...