DEGS1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59941

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all DEGS1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to DEGS1(degenerative spermatocyte homolog 1, lipid desaturase (Drosophila)) The peptide sequence was selected from the N terminal of DEGS1 (NP_003667). Peptide sequence GSRVSREDFEWVYTDQPHADRRREILAKYPEIKSLMKPDPNLIWIIIMMV The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

38 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for DEGS1 Antibody - BSA Free

Western Blot: DEGS1 Antibody [NBP1-59941]

Western Blot: DEGS1 Antibody [NBP1-59941]

Western Blot: DEGS1 Antibody [NBP1-59941] - Positive control (+): 293T (2T). Negative control (-): MCF7 (N10). Antibody concentration: 1ug/ml
Immunohistochemistry: DEGS1 Antibody [NBP1-59941]

Immunohistochemistry: DEGS1 Antibody [NBP1-59941]

Immunohistochemistry: DEGS1 Antibody [NBP1-59941] - Human Lung Tissue Observed Staining: Cytoplasm of pneumocytes Primary Antibody Concentration: 1 : 600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec.
Western Blot: DEGS1 Antibody [NBP1-59941]

Western Blot: DEGS1 Antibody [NBP1-59941]

Western Blot: DEGS1 Antibody [NBP1-59941] - Human Muscle lysate, concentration 0.2-1 ug/ml.

Applications for DEGS1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DEGS1

DEGS1 is a member of the membrane fatty acid desaturase family which is responsible for inserting double bonds into specific positions in fatty acids. This protein contains three His-containing consensus motifs that are characteristic of a group of membrane fatty acid desaturases. It is predicted to be a multiple membrane-spanning protein localized to the endoplasmic reticulum. Overexpression of this protein inhibited biosynthesis of the EGF receptor, suggesting a possible role of a fatty acid desaturase in regulating biosynthetic processing of the EGF receptor.This gene encodes a member of the membrane fatty acid desaturase family which is responsible for inserting double bonds into specific positions in fatty acids. This protein contains three His-containing consensus motifs that are characteristic of a group of membrane fatty acid desaturases. It is predicted to be a multiple membrane-spanning protein localized to the endoplasmic reticulum. Overexpression of this gene inhibited biosynthesis of the EGF receptor, suggesting a possible role of a fatty acid desaturase in regulating biosynthetic processing of the EGF receptor. Two splice variants have been identified.

Long Name

Sphingolipid delta(4)-desaturase DES1

Alternate Names

DES1, EC 1.14.19.17, EC 5.2.1.-, MIG15, Retinol isomerase

Entrez Gene IDs

8560 (Human)

Gene Symbol

DEGS1

UniProt

O15121 (Human)

Additional DEGS1 Products

Product Documents for DEGS1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for DEGS1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DEGS1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DEGS1 Antibody - BSA Free and earn rewards!

Have you used DEGS1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies