Delta 1 Tubulin Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-87391

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: VFQPTYSAESSFHYRRNPLGDLMEHLVPHPEFKMLSVRNIPHMSENSLAYTTFTWAGLLKHLRQMLISNAKMEEGID

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Delta 1 Tubulin Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Delta 1 Tubulin Antibody [NBP1-87391]

Immunocytochemistry/ Immunofluorescence: Delta 1 Tubulin Antibody [NBP1-87391]

Immunocytochemistry/Immunofluorescence: Delta 1 Tubulin Antibody [NBP1-87391] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.
Delta 1 Tubulin Antibody - BSA Free Immunohistochemistry-Paraffin: Delta 1 Tubulin Antibody [NBP1-87391]

Immunohistochemistry-Paraffin: Delta 1 Tubulin Antibody [NBP1-87391]

Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.
Delta 1 Tubulin Antibody - BSA Free Immunohistochemistry-Paraffin: Delta 1 Tubulin Antibody [NBP1-87391]

Immunohistochemistry-Paraffin: Delta 1 Tubulin Antibody [NBP1-87391]

Staining of human skin shows strong cytoplasmic positivity in melanocytes.
Delta 1 Tubulin Antibody - BSA Free Immunohistochemistry-Paraffin: Delta 1 Tubulin Antibody [NBP1-87391]

Immunohistochemistry-Paraffin: Delta 1 Tubulin Antibody [NBP1-87391]

Staining of human testis shows moderate cytoplasmic positivity in Leydig cells.
Delta 1 Tubulin Antibody - BSA Free Immunohistochemistry-Paraffin: Delta 1 Tubulin Antibody [NBP1-87391]

Immunohistochemistry-Paraffin: Delta 1 Tubulin Antibody [NBP1-87391]

Staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.
Delta 1 Tubulin Antibody - BSA Free Immunohistochemistry-Paraffin: Delta 1 Tubulin Antibody [NBP1-87391]

Immunohistochemistry-Paraffin: Delta 1 Tubulin Antibody [NBP1-87391]

Staining of human esophagus shows moderate cytoplasmic positivity in squamous epithelial cells.

Applications for Delta 1 Tubulin Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry-Paraffin

1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Delta 1 Tubulin

In the elongating spermatid it is associated with the manchette, a specialized microtubule system present during reshaping of the sperm head

Long Name

Tubulin delta chain

Alternate Names

Delta-tubulin, TUBD, TUBD1

Gene Symbol

TUBD1

Additional Delta 1 Tubulin Products

Product Documents for Delta 1 Tubulin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Delta 1 Tubulin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Delta 1 Tubulin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Delta 1 Tubulin Antibody - BSA Free and earn rewards!

Have you used Delta 1 Tubulin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...