Derlin 1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-88023

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LMFRYPMDLGGRNFLSTPQFLYRWLPSRRGGVSGFGVPPASMRRAADQNGGGGRHNWGQGFRLGDQ

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Derlin 1 Antibody - BSA Free

Immunohistochemistry-Paraffin: Derlin 1 Antibody [NBP1-88023]

Immunohistochemistry-Paraffin: Derlin 1 Antibody [NBP1-88023]

Immunohistochemistry-Paraffin: Derlin 1 Antibody [NBP1-88023] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: Derlin 1 Antibody [NBP1-88023]

Immunohistochemistry-Paraffin: Derlin 1 Antibody [NBP1-88023]

Immunohistochemistry-Paraffin: Derlin 1 Antibody [NBP1-88023] - Staining of human tonsil shows moderate to strong cytoplasmic positivity in lymphoid cells.
Immunohistochemistry-Paraffin: Derlin 1 Antibody [NBP1-88023]

Immunohistochemistry-Paraffin: Derlin 1 Antibody [NBP1-88023]

Immunohistochemistry-Paraffin: Derlin 1 Antibody [NBP1-88023] - Staining of human lung shows moderate to strong cytoplasmic positivity in macrophages.
Immunohistochemistry-Paraffin: Derlin 1 Antibody [NBP1-88023]

Immunohistochemistry-Paraffin: Derlin 1 Antibody [NBP1-88023]

Immunohistochemistry-Paraffin: Derlin 1 Antibody [NBP1-88023] - Staining of human small intestine shows moderate to strong cytoplasmic positivity in lymphoid cells and in glandular cells.
Derlin 1 Antibody - BSA Free Western Blot: Derlin 1 Antibody - BSA Free [NBP1-88023]

Western Blot: Derlin 1 Antibody - BSA Free [NBP1-88023]

Analysis in human cell line MCF-7.
Derlin 1 Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: Derlin 1 Antibody [NBP1-88023]

Immunocytochemistry/ Immunofluorescence: Derlin 1 Antibody [NBP1-88023]

Staining of human cell line U-2 OS shows localization to endoplasmic reticulum.

Applications for Derlin 1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,fixation permeabilization: PFA/Triton X-100

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Derlin 1

Degradation in Endoplasmic Reticulum protein 1 (Derlin1) is a channel-like protein, found in the ER membrane, responsible for degrading and funneling misfolded proteins and other cellular debris into the appropriate degradative pathways within the cell. Specifically, Derlin-1 is thought to form a channel to allow retrotranslocation of misfolded proteins into the cytosol where they may be ubiquitinated and degraded by the proteasome.

Derlin 1 antibodies will serve as useful tools for protein degradation studies and for research on certian types of cancers.

Alternate Names

DER-1, DER1Degradation in endoplasmic reticulum protein 1, Der1-like domain family, member 1, Der1-like protein 1, derlin-1, DERtrin-1, FLJ13784, FLJ42092, MGC3067, PRO2577

Gene Symbol

DERL1

Additional Derlin 1 Products

Product Documents for Derlin 1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Derlin 1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Derlin 1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Derlin 1 Antibody - BSA Free and earn rewards!

Have you used Derlin 1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...