Dexras1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-91830

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (98%), Rat (98%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: TKENVDVPLVICGNKGDRDFYREVDQREIEQLVGDDPQRCAYFE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Dexras1 Antibody - BSA Free

Western Blot: Dexras1 Antibody [NBP1-91830]

Western Blot: Dexras1 Antibody [NBP1-91830]

Western Blot: Dexras1 Antibody [NBP1-91830] - Analysis in control (vector only transfected HEK293T lysate) and RASD1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: Dexras1 Antibody [NBP1-91830]

Immunocytochemistry/ Immunofluorescence: Dexras1 Antibody [NBP1-91830]

Immunocytochemistry/Immunofluorescence: Dexras1 Antibody [NBP1-91830] - Staining of human cell line MCF7 shows localization to nucleoplasm & plasma membrane. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Dexras1 Antibody [NBP1-91830]

Immunohistochemistry-Paraffin: Dexras1 Antibody [NBP1-91830]

Immunohistochemistry-Paraffin: Dexras1 Antibody [NBP1-91830] - Staining of human testis shows moderate to strong cytoplasmic, membranous and nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: Dexras1 Antibody [NBP1-91830]

Immunohistochemistry-Paraffin: Dexras1 Antibody [NBP1-91830]

Immunohistochemistry-Paraffin: Dexras1 Antibody [NBP1-91830] - Staining of human cerebral cortex shows weak cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: Dexras1 Antibody [NBP1-91830]

Immunohistochemistry-Paraffin: Dexras1 Antibody [NBP1-91830]

Immunohistochemistry-Paraffin: Dexras1 Antibody [NBP1-91830] - Staining of human kidney shows strong membranous and cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: Dexras1 Antibody [NBP1-91830]

Immunohistochemistry-Paraffin: Dexras1 Antibody [NBP1-91830]

Immunohistochemistry-Paraffin: Dexras1 Antibody [NBP1-91830] - Staining of human placenta shows moderate cytoplasmic and membranous positivity in trophoblastic cells.
Dexras1 Antibody - BSA Free Western Blot: Dexras1 Antibody - BSA Free [NBP1-91830]

Western Blot: Dexras1 Antibody - BSA Free [NBP1-91830]

Analysis in control (vector only transfected HEK293T lysate) and RASD1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

Applications for Dexras1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Dexras1

Dexras1, also known as Dexamethasone-induced Ras-related protein 1 and RASD1, is a 32 kDa 281 amino acid protein with a shorter 14 kDa 122 isoform produced by alternative splicing. By interacting with APBB1, Dexras1 functions as a negative regulator of the activities of APBB1. Current research on Dexras1 is being conducted in its relation to myeloma, smith-magenis syndrome, Alzheimer's disease, leiomyosarcoma, neuronitis, prostate leiomyosarcoma, gigantism, prostatitis and pancreatitis. Dexras1 is linked to the cell proliferation, virulence, pathogenesis, hormone secretion, MAP kinase signaling and transport pathways where it interacts with NOS1, PLSCR1, GNAI1, GNAI2 and GNB1.

Alternate Names

Activator of G-protein signaling 1, AGS1ras-related protein, DEXRAS1dexamethasone-induced Ras-related protein 1, MGC:26290, RAS, dexamethasone-induced 1

Gene Symbol

RASD1

Additional Dexras1 Products

Product Documents for Dexras1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Dexras1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Dexras1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Dexras1 Antibody - BSA Free and earn rewards!

Have you used Dexras1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...