DNAJC7 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-86920

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: ATLMMLGRFREALGDAQQSVRLDDSFVRGHLREGKCHLSLGNAMAACRSFQRALELDHKNAQAQQEFKNANAVME

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for DNAJC7 Antibody - BSA Free

DNAJC7 Antibody - BSA Free Immunohistochemistry-Paraffin: DNAJC7 Antibody - BSA Free [NBP1-86920]

Immunohistochemistry-Paraffin: DNAJC7 Antibody - BSA Free [NBP1-86920]

Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.
DNAJC7 Antibody - BSA Free Immunohistochemistry-Paraffin: DNAJC7 Antibody - BSA Free [NBP1-86920]

Immunohistochemistry-Paraffin: DNAJC7 Antibody - BSA Free [NBP1-86920]

Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
DNAJC7 Antibody - BSA Free Immunohistochemistry-Paraffin: DNAJC7 Antibody - BSA Free [NBP1-86920]

Immunohistochemistry-Paraffin: DNAJC7 Antibody - BSA Free [NBP1-86920]

Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.
DNAJC7 Antibody - BSA Free Immunohistochemistry-Paraffin: DNAJC7 Antibody - BSA Free [NBP1-86920]

Immunohistochemistry-Paraffin: DNAJC7 Antibody - BSA Free [NBP1-86920]

Staining of human colon shows strong cytoplasmic positivity in glandular cells.
DNAJC7 Antibody - BSA Free Western Blot: DNAJC7 Antibody - BSA Free [NBP1-86920]

Western Blot: DNAJC7 Antibody - BSA Free [NBP1-86920]

Analysis in human cell line HEK 293.
DNAJC7 Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: DNAJC7 Antibody [NBP1-86920]

Immunocytochemistry/ Immunofluorescence: DNAJC7 Antibody [NBP1-86920]

Staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.

Applications for DNAJC7 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DNAJC7

DNAJC7 belongs to the evolutionarily conserved DNAJ/HSP40 family of proteins, which regulate molecular chaperone activity by stimulating ATPase activity. DNAJ proteins may have up to 3 distinct domains: a conserved 70-amino acid J domain, usually at the N terminus; a glycine/phenylalanine (G/F)-rich region; and a cysteine-rich domain containing 4 motifs resembling a zinc finger domain (Ohtsuka and Hata, 2000 [PubMed 11147971]).[supplied by OMIM]

Alternate Names

DANJC7, DJ11, DnaJ (Hsp40) homolog, subfamily C, member 7, tetratricopeptide repeat domain 2, Tetratricopeptide repeat protein 2, TPR repeat protein 2, TPR2DJC7, TTC2dnaJ homolog subfamily C member 7

Gene Symbol

DNAJC7

Additional DNAJC7 Products

Product Documents for DNAJC7 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DNAJC7 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DNAJC7 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DNAJC7 Antibody - BSA Free and earn rewards!

Have you used DNAJC7 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...