Dysbindin Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-85299

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LVELQEQLQQLPALIADLESMTANLTHLEASFEEVENNLLHLEDLCGQCELERCKHMQSQQLENYKK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Dysbindin Antibody - BSA Free

Western Blot: Dysbindin Antibody [NBP1-85299]

Western Blot: Dysbindin Antibody [NBP1-85299]

Western Blot: Dysbindin Antibody [NBP1-85299] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: Dysbindin Antibody [NBP1-85299]

Immunocytochemistry/ Immunofluorescence: Dysbindin Antibody [NBP1-85299]

Immunocytochemistry/Immunofluorescence: Dysbindin Antibody [NBP1-85299] - Staining of human cell line A-431 shows localization to microtubules. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Dysbindin Antibody [NBP1-85299]

Immunohistochemistry-Paraffin: Dysbindin Antibody [NBP1-85299]

Immunohistochemistry-Paraffin: Dysbindin Antibody [NBP1-85299] - Staining of human liver shows negative positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: Dysbindin Antibody [NBP1-85299]

Immunohistochemistry-Paraffin: Dysbindin Antibody [NBP1-85299]

Immunohistochemistry-Paraffin: Dysbindin Antibody [NBP1-85299] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: Dysbindin Antibody [NBP1-85299]

Immunohistochemistry-Paraffin: Dysbindin Antibody [NBP1-85299]

Immunohistochemistry-Paraffin: Dysbindin Antibody [NBP1-85299] - Staining of human lymph node shows very strong cytoplasmic positivity in germinal center cells.
Immunohistochemistry-Paraffin: Dysbindin Antibody [NBP1-85299]

Immunohistochemistry-Paraffin: Dysbindin Antibody [NBP1-85299]

Immunohistochemistry-Paraffin: Dysbindin Antibody [NBP1-85299] - Staining of human pancreas shows weak cytoplasmic positivity in exocrine glandular cells.

Applications for Dysbindin Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Dysbindin

Dysbindin encodes a protein that may play a role in organelle biogenesis associated with melanosomes, platelet dense granules, and lysosomes. A similar protein in mouse is a component of a protein complex termed biogenesis of lysosome-related organelles complex 1 (BLOC-1), and binds to alpha- and beta-dystrobrevins, which are components of the dystrophin-associated protein complex (DPC). Mutations in this gene are associated with Hermansky-Pudlak syndrome type 7. This gene may also be associated with schizophrenia. Multiple transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq]

Alternate Names

DKFZp564K192, Dysbindin, dysbindin-1, dystrobrevin binding protein 1, Dystrobrevin-binding protein 1, FLJ30031, Hermansky-Pudlak syndrome 7 protein, HPS7 protein, HPS7DBND, MGC20210, My031, SDY

Gene Symbol

DTNBP1

Additional Dysbindin Products

Product Documents for Dysbindin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Dysbindin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Dysbindin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Dysbindin Antibody - BSA Free and earn rewards!

Have you used Dysbindin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...