EBP Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-85699

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: YEDLLGDQAFLSQLWKEYAKGDSRYILGDNF

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (81%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for EBP Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: EBP Antibody [NBP1-85699]

Immunocytochemistry/ Immunofluorescence: EBP Antibody [NBP1-85699]

Immunocytochemistry/Immunofluorescence: EBP Antibody [NBP1-85699] - Staining of human cell line U-251 MG shows localization to endoplasmic reticulum. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: EBP Antibody [NBP1-85699]

Immunohistochemistry-Paraffin: EBP Antibody [NBP1-85699]

Immunohistochemistry-Paraffin: EBP Antibody [NBP1-85699] - Staining of human testis shows strong granular cytoplasmic positivity in Leydig cells.
Immunohistochemistry-Paraffin: EBP Antibody [NBP1-85699]

Immunohistochemistry-Paraffin: EBP Antibody [NBP1-85699]

Immunohistochemistry-Paraffin: EBP Antibody [NBP1-85699] - Staining of human gastrointestinal shows weak granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: EBP Antibody [NBP1-85699]

Immunohistochemistry-Paraffin: EBP Antibody [NBP1-85699]

Immunohistochemistry-Paraffin: EBP Antibody [NBP1-85699] - Staining of human liver shows moderate granular cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: EBP Antibody [NBP1-85699]

Immunohistochemistry-Paraffin: EBP Antibody [NBP1-85699]

Immunohistochemistry-Paraffin: EBP Antibody [NBP1-85699] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Applications for EBP Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: EBP

The protein encoded by the EBP gene is an integral membrane protein of the endoplasmic reticulum. It is a high affinity binding protein for the antiischemic phenylalkylamine Ca2+ antagonist (3H)emopamil and the photoaffinity label (3H)azidopamil. It is similar to sigma receptors and may be a member of a superfamily of high affinity drug-binding proteins in the endoplasmic reticulum of different tissues. This protein shares structural features with bacterial and eukaryontic drug transporting proteins. It has four putative transmembrane segments and contains two conserved glutamate residues which may be involved in the transport of cationic amphiphilics. Another prominent feature of this protein is its high content of aromatic amino acid residues (>23%) in its transmembrane segments. These aromatic amino acid residues have been suggested to be involved in the drug transport by the P-glycoprotein. Mutations in this gene cause Chondrodysplasia punctata 2 (CDPX2; also known as Conradi-Hunermann syndrome). (provided by RefSeq)

Long Name

3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase

Alternate Names

EC 5.3.3.5

Gene Symbol

EBP

Additional EBP Products

Product Documents for EBP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for EBP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for EBP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review EBP Antibody - BSA Free and earn rewards!

Have you used EBP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...