EDF1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87328

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human EDF1. Peptide sequence: INEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGKPIEKGPRAK The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for EDF1 Antibody - BSA Free

Western Blot: EDF1 Antibody [NBP2-87328]

Western Blot: EDF1 Antibody [NBP2-87328]

Western Blot: EDF1 Antibody [NBP2-87328] - WB Suggested Anti-EDF1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Human brain
Immunocytochemistry/ Immunofluorescence: EDF1 Antibody [NBP2-87328]

Immunocytochemistry/ Immunofluorescence: EDF1 Antibody [NBP2-87328]

Immunocytochemistry/Immunofluorescence: EDF1 Antibody [NBP2-87328] - Sample Type : Fibroblasts.
Immunohistochemistry: EDF1 Antibody [NBP2-87328]

Immunohistochemistry: EDF1 Antibody [NBP2-87328]

Immunohistochemistry: EDF1 Antibody [NBP2-87328] - Immunohistochemistry with Prostate tissue at an antibody concentration of 5ug/ml using anti-EDF1 antibody

Applications for EDF1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: EDF1

EDF1 encodes a protein that may regulate endothelial cell differentiation. It has been postulated that the protein functions as a bridging molecule that interconnects regulatory proteins and the basal transcriptional machinery, thereby modulating the transcription of genes involved in endothelial differentiation. This protein has also been found to act as a transcriptional coactivator by interconnecting the general transcription factor TATA element-binding protein (TBP) and gene-specific activators. Two alternatively spliced transcripts which encode distinct proteins have been found for this gene.

Alternate Names

EDF-1Multiprotein-bridging factor 1, endothelial differentiation-related factor 1, MBF1, MGC9058, multiprotein bridging factor 1, multiprotein bridging factor-1

Gene Symbol

EDF1

Additional EDF1 Products

Product Documents for EDF1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for EDF1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for EDF1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review EDF1 Antibody - BSA Free and earn rewards!

Have you used EDF1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...