EEF1G Antibody (2E1O7)
Novus Biologicals | Catalog # NBP3-16694
Recombinant Monoclonal Antibody
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 2E1O7 expressed in HEK293
Loading...
Product Specifications
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-123 of human EEF1G (P26641). MAAGTLYTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVFESNAIAYYVSNEELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHH
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for EEF1G Antibody (2E1O7)
Western Blot: EEF1G Antibody (2E1O7) [NBP3-16694]
Western Blot: EEF1G Antibody (2E1O7) [NBP3-16694] - Western blot analysis of extracts of various cell lines, using EEF1G Rabbit mAb (NBP3-16694) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.Immunocytochemistry/ Immunofluorescence: EEF1G Antibody (2E1O7) [NBP3-16694] -
Immunocytochemistry/ Immunofluorescence: EEF1G Antibody (2E1O7) [NBP3-16694] - Immunofluorescence analysis of HeLa cells using EEF1G Rabbit mAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.Immunohistochemistry: EEF1G Antibody (2E1O7) [NBP3-16694] -
Immunohistochemistry: EEF1G Antibody (2E1O7) [NBP3-16694] - Immunohistochemistry analysis of EEF1G in paraffin-embedded mouse brain tissue using EEF1G Rabbit mAb at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.Immunohistochemistry: EEF1G Antibody (2E1O7) [NBP3-16694] -
Immunohistochemistry: EEF1G Antibody (2E1O7) [NBP3-16694] - Immunohistochemistry analysis of EEF1G in paraffin-embedded human liver tissue using EEF1G Rabbit mAb at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.Immunohistochemistry: EEF1G Antibody (2E1O7) [NBP3-16694] -
Immunohistochemistry: EEF1G Antibody (2E1O7) [NBP3-16694] - Immunohistochemistry analysis of EEF1G in paraffin-embedded rat brain tissue using EEF1G Rabbit mAb at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.Immunocytochemistry/ Immunofluorescence: EEF1G Antibody (2E1O7) [NBP3-16694] -
Immunocytochemistry/ Immunofluorescence: EEF1G Antibody (2E1O7) [NBP3-16694] - Immunofluorescence analysis of NIH-3T3 cells using EEF1G Rabbit mAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.Applications for EEF1G Antibody (2E1O7)
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
1:50 - 1:200
Immunohistochemistry
1:50 - 1:200
Immunohistochemistry-Paraffin
1:50-1:200
Western Blot
1:500 - 1:2000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: EEF1G
Alternate Names
eEF-1B gamma, EF-1-gamma, EF1Gelongation factor 1-gamma, eukaryotic translation elongation factor 1 gamma, GIG35, pancreatic tumor-related protein, PRO1608, translation elongation factor eEF-1 gamma chain
Gene Symbol
EEF1G
Additional EEF1G Products
Product Documents for EEF1G Antibody (2E1O7)
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for EEF1G Antibody (2E1O7)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for EEF1G Antibody (2E1O7)
There are currently no reviews for this product. Be the first to review EEF1G Antibody (2E1O7) and earn rewards!
Have you used EEF1G Antibody (2E1O7)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...