EIF2AK1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-56484

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all EIF2AK1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to EIF2AK1(eukaryotic translation initiation factor 2-alpha kinase 1) The peptide sequence was selected from the N terminal of EIF2AK1. Peptide sequence TCSDEFSSLRLHHNRAITHLMRSAKERVRQDPCEDISRIQKIRSREVALE. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for EIF2AK1 Antibody - BSA Free

Western Blot: EIF2AK1 Antibody [NBP1-56484]

Western Blot: EIF2AK1 Antibody [NBP1-56484]

Western Blot: EIF2AK1 Antibody [NBP1-56484] - Human Hela, Antibody Dilution: 1.0 ug/ml EIF2AK1 is strongly supported by BioGPS gene expression data to be expressed in HeLa.
Immunohistochemistry-Paraffin: EIF2AK1 Antibody [NBP1-56484]

Immunohistochemistry-Paraffin: EIF2AK1 Antibody [NBP1-56484]

Immunohistochemistry-Paraffin: EIF2AK1 Antibody [NBP1-56484] - Human Lung tissue, 5ug/ml.
Western Blot: EIF2AK1 Antibody [NBP1-56484]

Western Blot: EIF2AK1 Antibody [NBP1-56484]

Western Blot: EIF2AK1 Antibody [NBP1-56484] - Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: Human Lung

Applications for EIF2AK1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: EIF2AK1

EIF2AK1 acts at the level of translation initiation to downregulate protein synthesis in response to stress. The protein is a kinase that can be inactivated by hemin. Two transcript variants encoding different isoforms have been found for this gene.The HRI gene is localized to 7p22 where its 3' end slightly overlaps the 3' end of the gene JTV1. The two genes are transcribed from opposite strands. Studies in rat and rabbit suggest that the HRI gene product phosphorylates the alpha subunit of eukaryotic initiation factor 2. Its kinase activity is induced by low levels of heme and inhibited by the presence of heme. Sequence Note: The sequence AF181071.1 is a chimeric mRNA clone. Only the heme-regulated initiation factor 2-alpha kinase region was propagated into this RefSeq record.

Alternate Names

EC 2.7.11, eukaryotic translation initiation factor 2-alpha kinase 1, HCR, heme sensitive initiation factor 2a kinase, Heme-controlled repressor, Heme-regulated eukaryotic initiation factor eIF-2-alpha kinase, Heme-regulated inhibitor, heme-regulated initiation factor 2-alpha kinase, heme-regulated repressor, Hemin-sensitive initiation factor 2-alpha kinase, HRIEC 2.7.11.1, KIAA1369heme regulated initiation factor 2 alpha kinase

Gene Symbol

EIF2AK1

UniProt

Q9BQI3 (Human)

Additional EIF2AK1 Products

Product Documents for EIF2AK1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for EIF2AK1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for EIF2AK1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review EIF2AK1 Antibody - BSA Free and earn rewards!

Have you used EIF2AK1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies