![Western Blot: ELF2 Antibody [NBP2-87348]](https://resources.rndsystems.com/images/products/ELF2-Antibody-Western-Blot-NBP2-87348-img0005.jpg "Western Blot: ELF2 Antibody [NBP2-87348]")
Select the "Bulk Orders" button to request additional sizes or formulations.
Loading...
Key Product Details
Species Reactivity
Human, Mouse
Applications
Immunohistochemistry-Paraffin, Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit
Format
BSA Free
Loading...
Product Specifications
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of human ELF2. Peptide sequence: TSPDSHEPMKKKKVGRKPKTQQSPISNGSPELGIKKKPREGKGNTTYLWE The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Scientific Data Images for ELF2 Antibody - BSA Free
Western Blot: ELF2 Antibody [NBP2-87348]
Western Blot: ELF2 Antibody [NBP2-87348] - Host: Mouse. Target Name: ELF2. Sample Tissue: Mouse Skeletal Muscle. Antibody Dilution: 1ug/ml![Immunohistochemistry-Paraffin: ELF2 Antibody [NBP2-87348]](https://resources.rndsystems.com/images/products/ELF2-Antibody-Immunohistochemistry-Paraffin-NBP2-87348-img0002.jpg "Immunohistochemistry-Paraffin: ELF2 Antibody [NBP2-87348]")
Immunohistochemistry-Paraffin: ELF2 Antibody [NBP2-87348]
Immunohistochemistry-Paraffin: ELF2 Antibody [NBP2-87348] - Rabbit Anti-ELF2 antibody. Formalin Fixed Paraffin Embedded Tissue: Human Skin. Primary antibody Concentration: 1:200. Secondary Antibody: Donkey anti-Rabbit-Cy3. Secondary Antibody Concentration: 1:200. Magnification: 20x.![Western Blot: ELF2 Antibody [NBP2-87348]](https://resources.rndsystems.com/images/products/ELF2-Antibody-Western-Blot-NBP2-87348-img0003.jpg "Western Blot: ELF2 Antibody [NBP2-87348]")
Western Blot: ELF2 Antibody [NBP2-87348]
Western Blot: ELF2 Antibody [NBP2-87348] - WB Suggested Anti-ELF2 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:12500. Positive Control: Jurkat cell lysate![Western Blot: ELF2 Antibody [NBP2-87348]](https://resources.rndsystems.com/images/products/ELF2-Antibody-Western-Blot-NBP2-87348-img0004.jpg "Western Blot: ELF2 Antibody [NBP2-87348]")
Western Blot: ELF2 Antibody [NBP2-87348]
Western Blot: ELF2 Antibody [NBP2-87348] - Host: Rabbit. Target Name: ELF2. Sample Type: Human Fetal Heart. Antibody Dilution: 1.0ug/ml![Immunohistochemistry-Paraffin: ELF2 Antibody [NBP2-87348]](https://resources.rndsystems.com/images/products/ELF2-Antibody-Immunohistochemistry-Paraffin-NBP2-87348-img0001.jpg "Immunohistochemistry-Paraffin: ELF2 Antibody [NBP2-87348]")
Immunohistochemistry-Paraffin: ELF2 Antibody [NBP2-87348]
Immunohistochemistry-Paraffin: ELF2 Antibody [NBP2-87348] - Rabbit Anti-ELF2 antibody. Formalin Fixed Paraffin Embedded Tissue: Human Kidney. Primary antibody Concentration: 1:200. Secondary Antibody: Donkey anti-Rabbit-Cy3. Secondary Antibody Concentration: 1:200. Magnification: 20x.Applications for ELF2 Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: ELF2
Alternate Names
b, E74-like factor 2, E74-like factor 2 (ets domain transcription factor), ets family transcription factor ELF2C, ETS-related transcription factor Elf-2, NERF-1a, NERF-1B, NERF-2, NERFEU32, New ETS-related factor
Gene Symbol
ELF2
Additional ELF2 Products
Product Documents for ELF2 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for ELF2 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for ELF2 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review ELF2 Antibody - BSA Free and earn rewards!
Have you used ELF2 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...