FALDH Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59679

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all FALDH Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to ALDH3A2(aldehyde dehydrogenase 3 family, member A2) The peptide sequence was selected from the middle region of ALDH3A2 (NP_001026976). Peptide sequence DHIFYTGNTAVGKIVMEAAAKHLTPVTLELGGKSPCYIDKDCDLDIVCRR. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

58 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for FALDH Antibody - BSA Free

Western Blot: FALDH Antibody [NBP1-59679]

Western Blot: FALDH Antibody [NBP1-59679]

Western Blot: FALDH Antibody [NBP1-59679] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.
Immunohistochemistry: FALDH Antibody [NBP1-59679]

Immunohistochemistry: FALDH Antibody [NBP1-59679]

Immunohistochemistry: FALDH Antibody [NBP1-59679] - Human Adult Adrenal Observed Staining: Cytoplasm in hepatocytes Primary Antibody Concentration: 1 : 600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Exposure Time: 0.5 2.0 sec.
Western Blot: FALDH Antibody [NBP1-59679]

Western Blot: FALDH Antibody [NBP1-59679]

Western Blot: FALDH Antibody [NBP1-59679] - NCI-H226 cell lysate, concentration 0.2-1 ug/ml.
Western Blot: FALDH Antibody [NBP1-59679]

Western Blot: FALDH Antibody [NBP1-59679]

Western Blot: FALDH Antibody [NBP1-59679] - Positive control: Lane1 : 30ug human Primary hepatocytes Primary, Antibody Dilution: 1 : 1000 Secondary Antibody: Anti-rabbit-HRP Secondry, Antibody Dilution: 1 : 5000.
Western Blot: FALDH Antibody [NBP1-59679]

Western Blot: FALDH Antibody [NBP1-59679]

Western Blot: FALDH Antibody [NBP1-59679] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Applications for FALDH Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FALDH

Aldehyde dehydrogenase isozymes are thought to play a major role in the detoxification of aldehydes generated by alcohol metabolism and lipid peroxidation. ALDH3A2 catalyzes the oxidation of long-chain aliphatic aldehydes to fatty acid.

Alternate Names

Aldehyde dehydrogenase 10, aldehyde dehydrogenase 3 family, member A2, Aldehyde dehydrogenase family 3 member A2, ALDH10FLJ20851, EC 1.2.1, EC 1.2.1.3, FALDHDKFZp686E23276, fatty aldehyde dehydrogenase, Microsomal aldehyde dehydrogenase, SLS

Entrez Gene IDs

224 (Human)

Gene Symbol

ALDH3A2

UniProt

P51648 (Human)

Additional FALDH Products

Product Documents for FALDH Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for FALDH Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for FALDH Antibody - BSA Free

There are currently no reviews for this product. Be the first to review FALDH Antibody - BSA Free and earn rewards!

Have you used FALDH Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies