FAM50A Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-89344
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Cited:
Human, Fish - Danio rerio (Zebrafish)
Predicted:
Mouse (95%), Rat (96%). Backed by our 100% Guarantee.
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Cited:
Western Blot, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VTLNDMKAKQEALVKEREKQLAKKEQSKELQMKLEKLREKERKKEAKRKISSLSFTLEEEEEGGEEEEEAAMYEEEMEREEITTKKRKLGKNPDVDTSFLPDRDRE
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for FAM50A Antibody - BSA Free
Western Blot: FAM50A Antibody [NBP1-89344]
Western Blot: FAM50A Antibody [NBP1-89344] - Analysis in human cell line U-251 MG.Immunohistochemistry-Paraffin: FAM50A Antibody [NBP1-89344]
Immunohistochemistry-Paraffin: FAM50A Antibody [NBP1-89344] - Staining of human prostate shows strong nuclear/ cytoplasmic positivity in glandular cells.Immunohistochemistry-Paraffin: FAM50A Antibody [NBP1-89344]
Immunohistochemistry-Paraffin: FAM50A Antibody [NBP1-89344] - Staining of human small intestine shows strong nuclear positivity in glandular cells.Immunohistochemistry-Paraffin: FAM50A Antibody [NBP1-89344]
Immunohistochemistry-Paraffin: FAM50A Antibody [NBP1-89344] - Staining of human cerebral cortex strong nuclear/cytoplasmic positivity in neurons.Immunohistochemistry-Paraffin: FAM50A Antibody [NBP1-89344]
Immunohistochemistry-Paraffin: FAM50A Antibody [NBP1-89344] - Staining of human skeletal muscle shows strong nuclear positivity in myocytes.Western Blot: FAM50A Antibody [NBP1-89344] -
Western Blot: FAM50A Antibody [NBP1-89344] - FAM50A interacts with U5 & C-complex proteins.a Schematic representation of the two-step splicing reaction (adapted from ref. 70). EFTUD2 (U5); FAM50A & DDX41 (C-complex). b Graphical representation of semi-native co-immunoprecipitation assay. Candidate interactors were overexpressed in U-87 cells, harvested in immunoprecipitation (IP) lysis buffer at 60 h post-transfection & immunoprecipitated with anti-FAM50A antibody. The interaction partners were detected in IP lysate using anti-V5 & anti-FAM50A antibodies, respectively. c, d Western blot of proteins after co-immunoprecipitation. Top: total protein lysate input (50 μg/lane) was migrated on 4–15% polyacrylamide gels to detect EFTUD2 (c) or DDX41 (d) using anti-V5 mouse monoclonal antibody. GAPDH was used as loading control. Bottom: Anti-FAM50A antibody was used to immunoprecipitate native FAM50A protein in total input lysate of 2.3 mg/condition (c) or 3.5 mg/condition (d). The IP lysate was separated in two parts (20% & 80%) & migrated independently on 4–15% polyacrylamide gels. The proteins of interest with predicated band sizes are indicated with black arrows. Plus & minus signs indicate presence & absence of relevant plasmids, respectively. EFTUD2 & DDX41 were detected in independent experiments using protein lysates derived from replicate batches of U-87 cells. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/32703943), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Immunocytochemistry/ Immunofluorescence: FAM50A Antibody [NBP1-89344]
Staining of human cell line U-2 OS shows localization to nucleoplasm.Applications for FAM50A Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:500 - 1:1000
Immunohistochemistry-Paraffin
1:500 - 1:1000
Western Blot
0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: FAM50A
Alternate Names
DXS9928EXAP-5 protein, family with sequence similarity 50, member A, HXC-26, Protein HXC-26, Protein XAP-5, XAP5HXC26,9F
Gene Symbol
FAM50A
Additional FAM50A Products
Product Documents for FAM50A Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for FAM50A Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for FAM50A Antibody - BSA Free
Customer Reviews for FAM50A Antibody - BSA Free
There are currently no reviews for this product. Be the first to review FAM50A Antibody - BSA Free and earn rewards!
Have you used FAM50A Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...