FBXW9 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-84714

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all FBXW9 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: VEEKNFDWPAACIALEQHLSRWAEDGRWVEYFCLAEGHVASVDSVLLLQGGSLCLSGSRDRNVNLWDLRQLGTESNQVLI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for FBXW9 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: FBXW9 Antibody [NBP1-84714]

Immunocytochemistry/ Immunofluorescence: FBXW9 Antibody [NBP1-84714]

Immunocytochemistry/Immunofluorescence: FBXW9 Antibody [NBP1-84714] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: FBXW9 Antibody [NBP1-84714]

Immunohistochemistry-Paraffin: FBXW9 Antibody [NBP1-84714]

Immunohistochemistry-Paraffin: FBXW9 Antibody [NBP1-84714] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.

Applications for FBXW9 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FBXW9

FBXW9, also known as F-box/WD repeat-containing protein 9, has 3 isoforms, a 488 amino acid isoform that is 54 kDa, a 478 amino acid isoform that is 53 kDa and a 458 amino acid isoform that is 51 kDa; acts as a substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex. The protein is being studied for its involvement in neuronitis. FBXW9 has been shown to have interactions with SKP1, COPS6 and UBC in association of TriC/CCT with target proteins during biosynthesis, chaperonin-mediated protein folding, metabolism of proteins, and protein folding pathways.

Alternate Names

F-box and WD repeat domain containing 9, F-box and WD-40 domain protein 9, F-box and WD-40 domain-containing protein 9, F-box and WD-40 repeat containing protein 9, specificity factor for SCF ubiquitin ligase

Gene Symbol

FBXW9

Additional FBXW9 Products

Product Documents for FBXW9 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for FBXW9 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for FBXW9 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review FBXW9 Antibody - BSA Free and earn rewards!

Have you used FBXW9 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies