FOXG1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86635

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human FOXG1. Peptide sequence: MLDMGDRKEVKMIPKSSFSINSLVPEAVQNDNHHASHGHHNSHHPQHHHH The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for FOXG1 Antibody - BSA Free

Western Blot: FOXG1 Antibody [NBP2-86635]

Western Blot: FOXG1 Antibody [NBP2-86635]

Western Blot: FOXG1 Antibody [NBP2-86635] - WB Suggested Anti-FOXG1B Antibody Titration: 1.25ug/ml. Positive Control: HepG2 cell lysate
Immunohistochemistry: FOXG1 Antibody [NBP2-86635]

Immunohistochemistry: FOXG1 Antibody [NBP2-86635]

Immunohistochemistry: FOXG1 Antibody [NBP2-86635] - Human kidney

Applications for FOXG1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FOXG1

Transcription repression factor which plays an important role in the establishment of the regional subdivision of the developing brain and in the development of the telencephalon. This gene participates in signal transduction Activin A signaling regulation, TGF-beta receptor signaling pathway, transcription factors in neurogenesis, as well as regulation of nuclear SMAD2/3 signaling. It is thought to interact with genes FOXO1, FOXO3, FOXO4, SMAD2, and SMAD3. FOXG1 is associated with diseases such as melanoma, neuronitis, glioblastoma, purpura, west syndrome, rett syndrome, medulloblastoma, hypotonia, retinitis, maternal uniparental disomy, chromosome 14, intellectual disabilities, brain malformations, multiple sclerosis, and lupus.

Alternate Names

BF-1, BF1HBF-2, BF2, BF-2, Brain factor 1, Brain factor 2, FHKL3, FKHL1forkhead-like 1, FKHL2, FKHL3, FKHL4, forkhead box G1, forkhead box G1A, forkhead box G1B, forkhead box G1C, Forkhead box protein G1A, Forkhead box protein G1B, Forkhead box protein G1C, forkhead-like 3, forkhead-like 4, Forkhead-related protein FKHL1, Forkhead-related protein FKHL2, Forkhead-related protein FKHL3, FOXG1A, FOXG1Bforkhead-like 2, FOXG1C, HBF-1, hBF-2, HBF-3, HFK1HBF-G2, HFK2HBF2, HFK3KHL2, oncogene QIN, QINFKH2forkhead box protein G1

Gene Symbol

FOXG1

Additional FOXG1 Products

Product Documents for FOXG1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for FOXG1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for FOXG1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review FOXG1 Antibody - BSA Free and earn rewards!

Have you used FOXG1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...