FUSIP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-46818

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: QPKKEMKAKSRSRSASHTKTRGTSKTDSKTHYKSGSRYEKESRKKEPPRSKSQS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for FUSIP1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: FUSIP1 Antibody [NBP2-46818]

Immunocytochemistry/ Immunofluorescence: FUSIP1 Antibody [NBP2-46818]

Immunocytochemistry/Immunofluorescence: FUSIP1 Antibody [NBP2-46818] - Staining of human rectum shows strong nuclear positivity in glandular cells.
Immunohistochemistry: FUSIP1 Antibody [NBP2-46818]

Immunohistochemistry: FUSIP1 Antibody [NBP2-46818]

Immunohistochemistry: FUSIP1 Antibody [NBP2-46818] - Staining of human tonsil shows moderate to strong nuclear positivity in non-germinal center cells.
Immunocytochemistry/ Immunofluorescence: FUSIP1 Antibody [NBP2-46818]

Immunocytochemistry/ Immunofluorescence: FUSIP1 Antibody [NBP2-46818]

Immunocytochemistry/Immunofluorescence: FUSIP1 Antibody [NBP2-46818] - Immunofluorescent staining of human cell line HEK 293 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: FUSIP1 Antibody [NBP2-46818]

Immunohistochemistry-Paraffin: FUSIP1 Antibody [NBP2-46818]

Immunohistochemistry-Paraffin: FUSIP1 Antibody [NBP2-46818] - Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: FUSIP1 Antibody [NBP2-46818]

Immunohistochemistry-Paraffin: FUSIP1 Antibody [NBP2-46818]

Immunohistochemistry-Paraffin: FUSIP1 Antibody [NBP2-46818] - Staining of human endometrium shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: FUSIP1 Antibody [NBP2-46818]

Immunohistochemistry-Paraffin: FUSIP1 Antibody [NBP2-46818]

Immunohistochemistry-Paraffin: FUSIP1 Antibody [NBP2-46818] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.

Applications for FUSIP1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FUSIP1

FUSIP1 product is a member of the serine-arginine (SR) family of proteins, which is involved in constitutive and regulated RNA splicing. Members of this family are characterized by N-terminal RNP1 and RNP2 motifs, which are required for binding to RNA, and multiple C-terminal SR/RS repeats, which are important in mediating association with other cellular proteins. This protein can influence splice site selection of adenovirus E1A pre-mRNA. It interacts with the oncoprotein TLS, and abrogates the influence of TLS on E1A pre-mRNA splicing. Alternative splicing of this gene results in at least two transcript variants encoding different isoforms. In addition, transcript variants utilizing alternative polyA sites exist.

Alternate Names

40 kDa SR-repressor protein, FLJ43846, FUS interacting protein (serine-arginine rich) 1, FUS-interacting protein (serine-arginine rich) 2, FUS-interacting serine-arginine-rich protein 1, FUSIP1DKFZp686H0644, FUSIP2, neural-salient SR protein, NSSR, serine/arginine-rich splicing factor 10, serine-arginine repressor protein (40 kDa), SFRS13, SFRS13A, Splicing factor SRp38, splicing factor, arginine/serine-rich 13, Splicing factor, arginine/serine-rich 13ATLS-associated protein with Ser-Arg repeats, SR splicing factor 10, SRp38, SRrp40TLS-associated protein with SR repeats, TASR1TLS-associated SR protein, TASR2FUS interacting protein (serine/arginine-rich) 1, TASRFLJ30749, TLS-associated protein TASR, TLS-associated serine-arginine protein, TLS-associated serine-arginine protein 1, TLS-associated serine-arginine protein 2

Entrez Gene IDs

10772 (Human)

Gene Symbol

SRSF10

UniProt

Additional FUSIP1 Products

Product Documents for FUSIP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for FUSIP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for FUSIP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review FUSIP1 Antibody - BSA Free and earn rewards!

Have you used FUSIP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...