gamma Sarcoglycan Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-59744
Loading...
Key Product Details
Species Reactivity
Validated:
Human, Mouse
Cited:
Mouse
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Frozen, Western Blot
Cited:
Immunohistochemistry-Frozen, Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
Synthetic peptides corresponding to SGCG(sarcoglycan, gamma (35kDa dystrophin-associated glycoprotein)) The peptide sequence was selected from the middle region of SGCG. Peptide sequence FTVDEKEVVVGTDKLRVTGPEGALFEHSVETPLVRADPFQDLRLESPTRS. The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Scientific Data Images for gamma Sarcoglycan Antibody - BSA Free
Western Blot: gamma Sarcoglycan Antibody [NBP1-59744]
Western Blot: gamma Sarcoglycan Antibody [NBP1-59744] - Lane 1 mouse Heart; 2 mouse Liver (expected negative); 3 mouse Liver; 4 mouse Quadriceps; 5 mouse Triceps; 6 mouse Triceps; 7 mouse Triceps. All lanes 25ug mouse protein. Image from verified customer review.Immunohistochemistry-Frozen: gamma Sarcoglycan Antibody [NBP1-59744]
Immunohistochemistry-Frozen: gamma Sarcoglycan Antibody [NBP1-59744] - Mouse tibialis anterior frozen sections. Image from verified customer review.Western Blot: gamma Sarcoglycan Antibody [NBP1-59744]
Western Blot: gamma Sarcoglycan Antibody [NBP1-59744] - Human Heart lysate, concentration 1.25ug/ml.Applications for gamma Sarcoglycan Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:10-1:500
Immunohistochemistry-Frozen
1:10-1:500
Western Blot
1.0 ug/ml
Application Notes
Frozen section data from customer review.
Reviewed Applications
Read 2 reviews rated 4.5 using NBP1-59744 in the following applications:
Formulation, Preparation, and Storage
Purification
Protein A purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
1 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: gamma-Sarcoglycan/SGCG
Long Name
Sarcoglycan, Gamma (35kDa Dystrophin-Associated Glycoprotein)
Alternate Names
DAGA4, DMDA, DMDA1, LGMD2C, LGMDR5, MGC130048, SCARMD2, SCG3
Gene Symbol
SGCG
UniProt
Additional gamma-Sarcoglycan/SGCG Products
Product Documents for gamma Sarcoglycan Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for gamma Sarcoglycan Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for gamma Sarcoglycan Antibody - BSA Free
Customer Reviews for gamma Sarcoglycan Antibody - BSA Free (2)
4.5 out of 5
2 Customer Ratings
Have you used gamma Sarcoglycan Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Customer Images
Showing
1
-
2 的
2 reviews
Showing All
Filter By:
-
Application: Immunohistochemistry-FrozenSample Tested: Mouse tibialis anteriorSpecies: MouseVerified Customer | Posted 08/28/2014
-
Application: Western BlotSample Tested: Mouse Heart, Liver, Quadriceps, and TricepsSpecies: MouseVerified Customer | Posted 08/13/2014Lane 1 Heart; 2 Liver (expected negative); 3 Liver; 4 Quadriceps; 5 Triceps; 6 Triceps; 7 Triceps. All lanes 25ug mouse protein
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...