GAS41 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10887

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all GAS41 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human GAS41 (NP_006521). Peptide sequence SRQLTLGAYKHETEFAELEVKTREKLEAAKKKTSFEIAELKERLKASRET

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for GAS41 Antibody - BSA Free

Immunohistochemistry-Paraffin: GAS41 Antibody [NBP3-10887]

Immunohistochemistry-Paraffin: GAS41 Antibody [NBP3-10887]

Immunohistochemistry-Paraffin: GAS41 Antibody [NBP3-10887] - Immunohistochemical analysis of paraffin-embedded human lung tissue.

Applications for GAS41 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GAS41

GAS41 is encoded by this gene is found in the nucleoli. It has high sequence homology to human MLLT1, and yeast and human MLLT3 proteins. Both MLLT1 and MLLT3 proteins belong to a class of transcription factors, indicating that the encoded protein might also represent a transcription factor. This protein is thought to be required for RNA transcription. This gene has been shown to be amplified in tumors.

Alternate Names

B230215M10Rik, Gas41,4930573H17Rik, GAS41glioma-amplified sequence-41, Glioma-amplified sequence 41, nuBI1, NuBI-1, NuMA binding protein 1, NuMA-binding protein 1, YAF9, YEATS domain containing 4, YEATS domain-containing protein 4

Gene Symbol

YEATS4

Additional GAS41 Products

Product Documents for GAS41 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GAS41 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GAS41 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GAS41 Antibody - BSA Free and earn rewards!

Have you used GAS41 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies