GCSH Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-85842

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Validated:

Western Blot, Immunocytochemistry/ Immunofluorescence, Simple Western

Cited:

Simple Western

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: TLRTGPALLSVRKFTEKHEWVTTENGIGTVGISNFAQEALGDVVYCSLPEVGTKLNKQDEFGA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for GCSH Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: GCSH Antibody [NBP1-85842]

Immunocytochemistry/ Immunofluorescence: GCSH Antibody [NBP1-85842]

Immunocytochemistry/Immunofluorescence: GCSH Antibody [NBP1-85842] - Staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.
Western Blot: GCSH Antibody [NBP1-85842]

Western Blot: GCSH Antibody [NBP1-85842]

Western Blot: GCSH Antibody [NBP1-85842] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue
GCSH Antibody - BSA Free Western Blot: GCSH Antibody - BSA Free [NBP1-85842]

Western Blot: GCSH Antibody - BSA Free [NBP1-85842]

Lane 1: Mouse liver tissue lysate
Lane 2: Rat liver tissue lysate

Applications for GCSH Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Simple Western

1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100
See Simple Western Antibody Database for Simple Western validation: Tested in Embryo, Muscle, separated by Size, antibody dilution of 1:50

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GCSH

The enzyme system for cleavage of glycine (glycine cleavage system; EC 2.1.2.10), which is confined to themitochondria, is composed of 4 protein components: P protein (a pyridoxal phosphate-dependent glycine decarboxylase;MIM 238300), H protein (a lipoic acid-containing protein), T protein (a tetrahydrofolate-requiring enzyme; MIM238310), and L protein (a lipoamide dehydrogenase; MIM 238331). Glycine encephalopathy (GCE; MIM 605899), also callednonketotic hyperglycinemia (NKH), may be due to a defect in any one of these enzymes.(supplied by OMIM)

Alternate Names

GCE, glycine cleavage system H protein, mitochondrial, glycine cleavage system protein H (aminomethyl carrier), lipoic acid-containing protein, mitochondrial glycine cleavage system H-protein, NKH

Gene Symbol

GCSH

Additional GCSH Products

Product Documents for GCSH Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GCSH Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for GCSH Antibody - BSA Free

Customer Reviews for GCSH Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GCSH Antibody - BSA Free and earn rewards!

Have you used GCSH Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...