GEM Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-58906
Loading...
Key Product Details
Species Reactivity
Validated:
Human, Mouse
Cited:
Mouse
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen, Western Blot, Immunocytochemistry/ Immunofluorescence
Cited:
Immunohistochemistry-Frozen, Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
Synthetic peptides corresponding to GEM(GTP binding protein overexpressed in skeletal muscle) The peptide sequence was selected from the C terminal of GEM (NP_005252). Peptide sequence ETSAAVQHNVKELFEGIVRQVRLRRDSKEKNERRLAYQKRKESMPRKARRFW The peptide sequence for this immunogen was taken from within the described region.
Reactivity Notes
Mouse reactivity reported in scientific literature (PMID: 24809506).
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Scientific Data Images for GEM Antibody - BSA Free
Western Blot: GEM Antibody [NBP1-58906]
Western Blot: GEM Antibody [NBP1-58906] - Human Stomach Tumor cell lysate. Antibody at 1.0 ug/mL.Immunohistochemistry: GEM Antibody [NBP1-58906]
Immunohistochemistry: GEM Antibody [NBP1-58906] - Human kidney tissue section. Magnification: 400X.Western Blot: GEM Antibody [NBP1-58906]
Western Blot: GEM Antibody [NBP1-58906] - HepG2 cell lysate. Antibody at 2.5 ug/mL.Immunohistochemistry-Paraffin: GEM Antibody [NBP1-58906]
Immunohistochemistry-Paraffin: GEM Antibody [NBP1-58906] - Human Skin Cellular Data: Squamous epithelial tissue section. Magnification: 400X.Applications for GEM Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:10 - 1:500
Immunohistochemistry-Paraffin
4 - 8 ug/mL
Western Blot
1.0 ug/ml
Application Notes
Use in Immunocytochemistry/immunofluorescence and Immunohistochemistry-Frozen reported in scientific literature (PMID 24809506).
Reviewed Applications
Read 1 review rated 4 using NBP1-58906 in the following applications:
Formulation, Preparation, and Storage
Purification
Protein A purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
1 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: GEM
Alternate Names
GTP binding protein overexpressed in skeletal muscle, GTP-binding mitogen-induced T-cell protein, GTP-binding protein GEM, GTP-binding protein overexpressed in skeletal muscle, kinase-inducible Ras-like protein, KIRMGC26294, RAS-like protein KIR
Entrez Gene IDs
2669 (Human)
Gene Symbol
GEM
UniProt
Additional GEM Products
Product Documents for GEM Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for GEM Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for GEM Antibody - BSA Free
Customer Reviews for GEM Antibody - BSA Free (1)
4 out of 5
1 Customer Rating
Have you used GEM Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Customer Images
Showing
1
-
1 的
1 review
Showing All
Filter By:
-
Application: Immunohistochemistry-FrozenSample Tested: Skeletal muscle and Skeletal muscle tissueSpecies: HumanVerified Customer | Posted 11/05/2020Human skeletal muscle (quadriceps) stained with anti-CCDC8 (green) and Hoechst (blue).Fixative: 4% paraformaldehyde Permeabilization: Methanol gradient (70% for 10 mins, 95% for 10 mins, 100% for 20 mins, 95% for 10 mins, 70% for 10 mins) Protein blocking: 10% NGS diluted in TBST Endogenous biotin blocking: Avidin D solution for 15 mins, Biotin for 15 mins (Vector Laboratories, Inc) Dilution: 1/50 Incubation time: 19 hour(s) and 0 minute(s) · Diluent TBST – NGS 10% Secondary antibody: Life tech/ThermoFisher, A11006, Alexa 488, anti-Rabbit isotype IgG, Host species: Goat, Clonality: Polyclonal
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...