![Western Blot: GJC2 Antibody [NBP1-59263]](https://resources.rndsystems.com/images/products/GJC2-Antibody-Western-Blot-NBP1-59263-img0006.jpg "Western Blot: GJC2 Antibody [NBP1-59263]")
Loading...
Key Product Details
Species Reactivity
Human
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
Synthetic peptides corresponding to GJC2(gap junction protein, gamma 2, 47kDa) The peptide sequence was selected from the middle region of GJC2. Peptide sequence APASRTGSATSAGTVGEQGRPGTHERPGAKPRAGSEKGSASSRDGKTTVW. The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
47 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Scientific Data Images for GJC2 Antibody - BSA Free
Western Blot: GJC2 Antibody [NBP1-59263]
Western Blot: GJC2 Antibody [NBP1-59263] - Antibody Titration: 1 ug/ml Human liver.![Immunohistochemistry: GJC2 Antibody [NBP1-59263]](https://resources.rndsystems.com/images/products/GJC2-Antibody-Immunohistochemistry-NBP1-59263-img0007.jpg "Immunohistochemistry: GJC2 Antibody [NBP1-59263]")
Immunohistochemistry: GJC2 Antibody [NBP1-59263]
Immunohistochemistry: GJC2 Antibody [NBP1-59263] - Formalin Fixed Paraffin Embedded Tissue: Human Adult heart Observed Staining: Membrane, some cytoplasm Primary Antibody Concentration: 1:100 Secondary Antibody: Donkey anti-Rabbit-Cy2/3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec Protocol located in Reviews and Data.![Western Blot: GJC2 Antibody [NBP1-59263]](https://resources.rndsystems.com/images/products/GJC2-Antibody-Western-Blot-NBP1-59263-img0002.jpg "Western Blot: GJC2 Antibody [NBP1-59263]")
Western Blot: GJC2 Antibody [NBP1-59263]
Western Blot: GJC2 Antibody [NBP1-59263] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.![Western Blot: GJC2 Antibody [NBP1-59263]](https://resources.rndsystems.com/images/products/GJC2-Antibody-Western-Blot-NBP1-59263-img0004.jpg "Western Blot: GJC2 Antibody [NBP1-59263]")
Western Blot: GJC2 Antibody [NBP1-59263]
Western Blot: GJC2 Antibody [NBP1-59263] - Analysis of 293T cell lysate. Antibody Dilution: 1.0 ug/ml GJC2 is supported by BioGPS gene expression data to be expressed in HEK293T.![Western Blot: GJC2 Antibody [NBP1-59263]](https://resources.rndsystems.com/images/products/GJC2-Antibody-Western-Blot-NBP1-59263-img0005.jpg "Western Blot: GJC2 Antibody [NBP1-59263]")
Western Blot: GJC2 Antibody [NBP1-59263]
Western Blot: GJC2 Antibody [NBP1-59263] - Antibody Titration: 1 ug/ml Human heart.![Immunohistochemistry: GJC2 Antibody [NBP1-59263]](https://resources.rndsystems.com/images/products/GJC2-Antibody-Immunohistochemistry-NBP1-59263-img0003.jpg "Immunohistochemistry: GJC2 Antibody [NBP1-59263]")
Immunohistochemistry: GJC2 Antibody [NBP1-59263]
Immunohistochemistry: GJC2 Antibody [NBP1-59263] - Human Adult heart Observed Staining: Membrane, some cytoplasm Primary Antibody Concentration: 1 : 100 Secondary Antibody: Donkey anti-Rabbit-Cy2/3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Exposure Time: 0.5 2.0 sec.Applications for GJC2 Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:100
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: GJC2
Alternate Names
connexin46.6, connexin-46.6, Connexin-47, CX46.6, CX47, Gap junction alpha-12 protein, gap junction gamma-2 protein, gap junction protein, alpha 12, 47kDa, gap junction protein, gamma 2, 47kDa, GJA12connexin 47, HLD2, LMPH1C, PMLDAR, SPG44MGC105119
Gene Symbol
GJC2
UniProt
Additional GJC2 Products
Product Documents for GJC2 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for GJC2 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for GJC2 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review GJC2 Antibody - BSA Free and earn rewards!
Have you used GJC2 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
FAQs for GJC2 Antibody - BSA Free
Showing
1
-
1 的
1 FAQ
Showing All
-
Q: Has this antibody been tested for immunofluorescence in human tissue (frozen or paraffin)? If not is it possible to send a vial FOC for us to try?
A:
It is company policy that we do not send out free samples. NBP2-13011 has never been tested in IHC, but NBP1-46567 has been validated for use in detecting connexin-37 in paraffin-embedded tissues and should work just fine for you. NBP1-59263 has not been tested in IHC and is our only antibody directed against connexin-47. If you would like to test this antibody in an untested application and share your results with us, then I can recommend our Innovators Reward Program. Under this program, Novus will provide you a 50% refund on the purchased product as well as a 50% discount on a future product of equal value in exchange for your new data.
Loading...