Glutathione S Transferase kappa 1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-37938

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Human

Applications

ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Glutathione S Transferase kappa 1 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-226 of human Glutathione S Transferase kappa 1 (NP_057001.1).

Sequence:
MGPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVNARL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Glutathione S Transferase kappa 1 Antibody - BSA Free

Glutathione S Transferase kappa 1 Antibody

Western Blot: Glutathione S Transferase kappa 1 Antibody [NBP3-37938] -

Western Blot: Glutathione S Transferase kappa 1 Antibody [NBP3-37938] - Western Blot analysis of various lysates using [KO Validated] Glutathione S Transferase kappa 1 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates / proteins: 25 ug per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
Glutathione S Transferase kappa 1 Antibody

Western Blot: Glutathione S Transferase kappa 1 Antibody [NBP3-37938] -

Western Blot: Glutathione S Transferase kappa 1 Antibody [NBP3-37938] - Western Blot analysis of lysates from wild type (WT) and Glutathione S Transferase kappa 1 knockout (KO) 293T cells using [KO Validated] Glutathione S Transferase kappa 1 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
Glutathione S Transferase kappa 1 Antibody

Immunocytochemistry/ Immunofluorescence: Glutathione S Transferase kappa 1 Antibody [NBP3-37938] -

Immunocytochemistry/ Immunofluorescence: Glutathione S Transferase kappa 1 Antibody [NBP3-37938] - Immunofluorescence analysis of Hela cells using [KO Validated] Glutathione S Transferase kappa 1 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for Glutathione S Transferase kappa 1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Glutathione S Transferase kappa 1

Glutathione transferases (GSTs) are a superfamily of enzymes that play a vital functional role in the cellular detoxification process. They catalyze the conjugation of the thiol group of glutathione (GSH) to the electrophilic groups of a wide range of hydrophobic substrates, leading to an easier removal of the latter from the cells (1) The Kappa class of GSTs comprises soluble enzymes originally isolated from the mitochondrial matrix of rats. Gsk1 catalyses some typical GST reactions, it has been proposed that it is structurally distinct from other classes of cytosolic GSTs (2). Gsk1 has been identified in rat, mouse, and human. The C terminus of Gsk1 was essential for localization of the protein to peroxisomes, and the C-terminal sequence Ala-Arg-Leu represents a peroxisome targeting signal (3).

Alternate Names

EC 2.5.1.18, glutathione S-transferase k1, glutathione S-transferase kappa 1, Glutathione S-transferase subunit 13, glutathione S-transferase subunit 13 homolog, GST, GST 13-13, GST class-kappa, GST13, GST13-13, GSTK1-1, hGSTK1

Gene Symbol

GSTK1

Additional Glutathione S Transferase kappa 1 Products

Product Documents for Glutathione S Transferase kappa 1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Glutathione S Transferase kappa 1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Glutathione S Transferase kappa 1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Glutathione S Transferase kappa 1 Antibody - BSA Free and earn rewards!

Have you used Glutathione S Transferase kappa 1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies