Glycogen synthase 2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-91191

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Glycogen synthase 2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: VPPSPSGSQASSPQSSDVEDEVEDERYDEEEEAERDRLNIKSPFSLSHVPHGKKKLHGEYKN

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (89%), Mouse (89%).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Glycogen synthase 2 Antibody - BSA Free

Immunohistochemistry-Paraffin: Glycogen synthase 2 Antibody [NBP1-91191]

Immunohistochemistry-Paraffin: Glycogen synthase 2 Antibody [NBP1-91191]

Immunohistochemistry-Paraffin: Glycogen synthase 2 Antibody [NBP1-91191] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Glycogen synthase 2 Antibody

Western Blot: Glycogen synthase 2 Antibody [NBP1-91191] -

Western Blot: Glycogen synthase 2 Antibody [NBP1-91191] - Analysis in human cell line CACO-2.
Glycogen synthase 2 Antibody - BSA Free Western Blot: Glycogen synthase 2 Antibody - BSA Free [NBP1-91191]

Western Blot: Glycogen synthase 2 Antibody - BSA Free [NBP1-91191]

Analysis in human cell line CACO-2.

Applications for Glycogen synthase 2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Glycogen synthase 2

The protein encoded by the Glycogen synthase 2 gene, liver glycogen synthase, catalyzes the rate-limiting step in the synthesis ofglycogen - the transfer of a glucose molecule from UDP-glucose to a terminal branch of the glycogen molecule.Mutations in this gene cause glycogen storage disease type 0 (GSD-0) - a rare type of early childhood fastinghypoglycemia with decreased liver glycogen content. (provided by RefSeq)

Alternate Names

EC 2.4.1.11, glycogen [starch] synthase, liver, glycogen synthase 2 (liver)

Gene Symbol

GYS2

Additional Glycogen synthase 2 Products

Product Documents for Glycogen synthase 2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Glycogen synthase 2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Glycogen synthase 2 Antibody - BSA Free

Customer Reviews for Glycogen synthase 2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Glycogen synthase 2 Antibody - BSA Free and earn rewards!

Have you used Glycogen synthase 2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies