GNAL Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-68695

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all GNAL Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: NQFRSDYIKSIAPITDFEYSQEFFDHVKKLWDDEGVKACFER

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for GNAL Antibody - BSA Free

Immunohistochemistry: GNAL Antibody [NBP2-68695]

Immunohistochemistry: GNAL Antibody [NBP2-68695]

Immunohistochemistry: GNAL Antibody [NBP2-68695] - Immunohistochemical staining of human caudate shows strong positivity in neuropil.

Applications for GNAL Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000
Application Notes
Recommended conditions for IHC,Retrieval method: HIER pH6

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GNAL

Heterotrimeric G proteins function to relay information from cell surface receptors to intracellular effectors. Each of a very broad range of receptors specifically detects an extracellular stimulus (a photon, pheromone, odorant, hormone or neurotransmitter) while the effectors (e.g. adenyl cyclase), which act to generate one or more intracellular messengers, are less numerous. In mammals, G protein alpha, beta and gamma polypeptides are encoded by at least 16, 4 and 7 genes, respectively. Most interest in G proteins has been focused on their alpha subunits, since these proteins bind and hydrolyze GTP, and most obviously regulate the activity of the best studied effectors. The Gs subfamily of Galpha subunits includes two closely related proteins, Galpha s and Galpha olf, which, respectively, stimulate adenylate cyclase and mediate response to olfactory stimuli.

Alternate Names

Adenylate cyclase-stimulating G alpha protein, olfactory type, guanine nucleotide binding protein (G protein), alpha activating activitypolypeptide, olfactory typ, guanine nucleotide binding protein (G protein), alpha activating activitypolypeptide, olfactory type, guanine nucleotide binding protein (G protein), alpha stimulating activitypolypeptide, olfactory type, guanine nucleotide-binding protein G(olf) subunit alpha

Gene Symbol

GNAL

Additional GNAL Products

Product Documents for GNAL Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for GNAL Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GNAL Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GNAL Antibody - BSA Free and earn rewards!

Have you used GNAL Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies