GSTO2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-14075

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: DVYGILDCVSHTPALRLWISAMKWDPTVCALLMDKSIFQGFLNLYFQNNPNAFDFG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for GSTO2 Antibody - BSA Free

Western Blot: GSTO2 Antibody [NBP2-14075]

Western Blot: GSTO2 Antibody [NBP2-14075]

Western Blot: GSTO2 Antibody [NBP2-14075] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue
Immunocytochemistry/ Immunofluorescence: GSTO2 Antibody [NBP2-14075]

Immunocytochemistry/ Immunofluorescence: GSTO2 Antibody [NBP2-14075]

Immunocytochemistry/Immunofluorescence: GSTO2 Antibody [NBP2-14075] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleus & nucleoli.
Immunohistochemistry-Paraffin: GSTO2 Antibody [NBP2-14075]

Immunohistochemistry-Paraffin: GSTO2 Antibody [NBP2-14075]

Immunohistochemistry-Paraffin: GSTO2 Antibody [NBP2-14075] - Staining of human fallopian tube shows moderate to strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: GSTO2 Antibody [NBP2-14075]

Immunohistochemistry-Paraffin: GSTO2 Antibody [NBP2-14075]

Immunohistochemistry-Paraffin: GSTO2 Antibody [NBP2-14075] - Staining of human prostate shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: GSTO2 Antibody [NBP2-14075]

Immunohistochemistry-Paraffin: GSTO2 Antibody [NBP2-14075]

Immunohistochemistry-Paraffin: GSTO2 Antibody [NBP2-14075] - Staining of human testis shows moderate nuclear positivity in a subset of cells in seminiferous ducts.
Immunohistochemistry-Paraffin: GSTO2 Antibody [NBP2-14075]

Immunohistochemistry-Paraffin: GSTO2 Antibody [NBP2-14075]

Immunohistochemistry-Paraffin: GSTO2 Antibody [NBP2-14075] - Staining of human prostate shows moderate to strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: GSTO2 Antibody [NBP2-14075]

Immunohistochemistry-Paraffin: GSTO2 Antibody [NBP2-14075]

Immunohistochemistry-Paraffin: GSTO2 Antibody [NBP2-14075] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Applications for GSTO2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GSTO2

The omega class glutathione transferases (GST; EC 2.5.1.18) have poor activity with common GST substrates, but exhibit novel glutathione-dependent thioltransferase, dehydroascorbate reductase, and monomethylarsonate reductase activities, and they modulate Ca(2+) release by ryanodine receptors (e.g., RYR1, MIM 180901) (Whitbread et al., 2003 [PubMed 12618591]). For background information on GSTs, see MIM 605482.[supplied by OMIM]

Alternate Names

bA127L20.1, bA127L20.1 (novel glutathione-S-transferase), EC 2.5.1.18, glutathione S-transferase omega 2, glutathione S-transferase omega-2, glutathione-S-transferase-like protein, GSTO-2

Gene Symbol

GSTO2

Additional GSTO2 Products

Product Documents for GSTO2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GSTO2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GSTO2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GSTO2 Antibody - BSA Free and earn rewards!

Have you used GSTO2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...