Guanylyl Cyclase beta 1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-89784

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human, Rat

Cited:

Rat

Predicted:

Mouse (100%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Simple Western

Cited:

Western Blot, Simple Western

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: HALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVAAASKVLNLNAGEILQMFGKMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLATIYPGMRAPSFRCTDAEKGKGLILHYYSEREGLQDIVIGII

Reactivity Notes

Use in Rat reported in scientific literature (PMID:34871799).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Guanylyl Cyclase beta 1 Antibody - BSA Free

Western Blot: Guanylyl Cyclase beta 1 Antibody [NBP1-89784]

Western Blot: Guanylyl Cyclase beta 1 Antibody [NBP1-89784]

Western Blot: Guanylyl Cyclase beta 1 Antibody [NBP1-89784] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunohistochemistry-Paraffin: Guanylyl Cyclase beta 1 Antibody [NBP1-89784]

Immunohistochemistry-Paraffin: Guanylyl Cyclase beta 1 Antibody [NBP1-89784]

Immunohistochemistry-Paraffin: Guanylyl Cyclase beta 1 Antibody [NBP1-89784] - Staining of human prostate shows strong cytoplasmic positivity in smooth muscle cells.
Immunohistochemistry-Paraffin: Guanylyl Cyclase beta 1 Antibody [NBP1-89784]

Immunohistochemistry-Paraffin: Guanylyl Cyclase beta 1 Antibody [NBP1-89784]

Immunohistochemistry-Paraffin: Guanylyl Cyclase beta 1 Antibody [NBP1-89784] - Staining of human cerebellum shows strong cytoplasmic positivity in molecular layer.
Immunohistochemistry-Paraffin: Guanylyl Cyclase beta 1 Antibody [NBP1-89784]

Immunohistochemistry-Paraffin: Guanylyl Cyclase beta 1 Antibody [NBP1-89784]

Immunohistochemistry-Paraffin: Guanylyl Cyclase beta 1 Antibody [NBP1-89784] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: Guanylyl Cyclase beta 1 Antibody [NBP1-89784]

Immunohistochemistry-Paraffin: Guanylyl Cyclase beta 1 Antibody [NBP1-89784]

Immunohistochemistry-Paraffin: Guanylyl Cyclase beta 1 Antibody [NBP1-89784] - Staining of human gastrointestinal shows strong cytoplasmic positivity in glandular cells.

Applications for Guanylyl Cyclase beta 1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Simple Western

1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
See Simple Western Antibody Database for Simple Western validation: Tested in Muscle, separated by Size, antibody dilution of 1:50

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Guanylyl Cyclase beta 1

Guanylate Cyclase is an heterodimer of an alpha and a beta chain. Its enzymatic activity transforms GTP to GMP releasing a diphosphate. It binds 1 or 2 hemes per heterodimer. It is activated by nitric oxide in the presence of magnesium or manganese ions. There are two types of guanylate cyclase: soluble form and membrane-associated receptor form.

Alternate Names

EC 4.6.1.2, GC-SB3, GCS-beta-1, GCS-beta-3, guanylate cyclase 1, soluble, beta 3, guanylate cyclase soluble subunit beta-1, Guanylate cyclase soluble subunit beta-3, GUC1B3GUCB3, GUCSB3GC-S-beta-1, GUCY1B1, Soluble guanylate cyclase small subunit

Gene Symbol

GUCY1B1

Additional Guanylyl Cyclase beta 1 Products

Product Documents for Guanylyl Cyclase beta 1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Guanylyl Cyclase beta 1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Guanylyl Cyclase beta 1 Antibody - BSA Free

Customer Reviews for Guanylyl Cyclase beta 1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Guanylyl Cyclase beta 1 Antibody - BSA Free and earn rewards!

Have you used Guanylyl Cyclase beta 1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Guanylyl Cyclase beta 1 Antibody - BSA Free

Showing  1 - 11 FAQ Showing All
  • Q: We are searching for antibodies raised against soluble guanylyl cyclase and NMDA-receptor. Both antibodies would be used on a mollusk (Helix pomatia). In some cases we could not find sequence information on your antibodies target. We can give you the sequences of both proteins described in a mollusk (Lymnaea) standing closest to that our target species. I hope some of your immunogen sequences used for antibody production will match with high confidence with a part of these protein sequences. Would you so kind as to help us finding the most promising antibody from your palette.

    A:

    In regards to your inquiry, unfortunately with this being an organism that is not commonly studied by our researchers we don't have many products that match up with this one. I ran an alignment on your sequences against our antibodies and have come to the conclusion we may have one for guanylyl cyclase beta-1 that has a small chance of working. Please follow this link to the product datasheet. This immunogen information is provided and you can run an alignment against the sequence you have shared with me. While it is not high enough for us to guarantee or recommend with a high likelihood of success, this would be your best option in my opinion and this is a high quality antibody that gets great feedback from our customers in the stated uses and species. Unfortunately for your other targets I was unable to track down any suitable candidates.

Showing  1 - 11 FAQ Showing All
View all FAQs for Antibodies
Loading...