Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-91982

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (95%), Rat (96%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: NQIQKLEESRSKLERAIARHEVREIEQRHTMDGPRQDATLDEEEDMVIIYNRVPKTASTSFTNIAYDLCAKNKYHVLH

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Antibody - BSA Free

Immunohistochemistry-Paraffin: Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Antibody [NBP1-91982]

Immunohistochemistry-Paraffin: Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Antibody [NBP1-91982]

Immunohistochemistry-Paraffin: Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Antibody [NBP1-91982] - Staining of human testis shows strong granular cytoplasmic positivity in Leydig cells.
Immunohistochemistry-Paraffin: Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Antibody [NBP1-91982]

Immunohistochemistry-Paraffin: Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Antibody [NBP1-91982]

Immunohistochemistry-Paraffin: Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Antibody [NBP1-91982] - Staining of human cerebral cortex shows granular cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Antibody [NBP1-91982]

Immunohistochemistry-Paraffin: Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Antibody [NBP1-91982]

Immunohistochemistry-Paraffin: Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Antibody [NBP1-91982] - Staining of human cerebral cortex shows moderate granular cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Antibody [NBP1-91982]

Immunohistochemistry-Paraffin: Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Antibody [NBP1-91982]

Immunohistochemistry-Paraffin: Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Antibody [NBP1-91982] - Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Antibody [NBP1-91982]

Immunohistochemistry-Paraffin: Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Antibody [NBP1-91982]

Immunohistochemistry-Paraffin: Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Antibody [NBP1-91982] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Applications for Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1

Heparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities. This gene encodes heparan sulfate 2-O-sulfotransferase, a member of the heparan sulfate biosynthetic enzyme family. This family member transfers sulfate to the 2 position of the iduronic acid residue of heparan sulfate. The disruption of this gene resulted in no kidney formation in knockout embryonic mice, indicating that the absence of this enzyme may interfere with the signaling required for kidney formation.

Alternate Names

2OST

Gene Symbol

HS2ST1

Additional Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Products

Product Documents for Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Antibody - BSA Free and earn rewards!

Have you used Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...

Associated Pathways

Articular Cartilage Extracellular Matrix
Articular Cartilage Extracellular Matrix Thumbnail