HERC4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10568

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all HERC4 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human HERC4 (NP_071362). Peptide sequence LVIQSTGGGEEYLPVSHTCFNLLDLPKYTEKETLRSKLIQAIDHNEGFSL

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

118 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for HERC4 Antibody - BSA Free

Immunohistochemistry-Paraffin: HERC4 Antibody [NBP3-10568]

Immunohistochemistry-Paraffin: HERC4 Antibody [NBP3-10568]

Immunohistochemistry-Paraffin: HERC4 Antibody [NBP3-10568] - Immunohistochemical analysis of formalin-fixed paraffin-embedded human liver tissue.

Applications for HERC4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HERC4

HERC4 belongs to the HERC family of ubiquitin ligases, all of which contain a HECT domain and at least 1 RCC1 (MIM 179710)-like domain (RLD). The 350-amino acid HECT domain is predicted to catalyze the formation of a thioester with ubiquitin before transferring it to a substrate, and the RLD is predicted to act as a guanine nucleotide exchange factor for small G proteins (Hochrainer et al., 2005 [PubMed 15676274]).[supplied by OMIM]

Alternate Names

DKFZp564G092, EC 6.3.2, EC 6.3.2.-, HECT domain and RCC1-like domain-containing protein 4, hect domain and RLD 4, KIAA1593probable E3 ubiquitin-protein ligase HERC4

Gene Symbol

HERC4

Additional HERC4 Products

Product Documents for HERC4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HERC4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HERC4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HERC4 Antibody - BSA Free and earn rewards!

Have you used HERC4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies