HIST1H2AB Antibody (1P5B6)

Novus Biologicals | Catalog # NBP3-15591

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunoprecipitation

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 1P5B6 expressed in HEK293
View all HIST1H2AB Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HIST1H2AB (P04908). MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGR

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for HIST1H2AB Antibody (1P5B6)

Western Blot: HIST1H2AB Antibody (1P5B6) [NBP3-15591]

Western Blot: HIST1H2AB Antibody (1P5B6) [NBP3-15591]

Western Blot: HIST1H2AB Antibody (1P5B6) [NBP3-15591] - Western blot analysis of extracts of Rat liver, using HIST1H2AB Rabbit mAb (NBP3-15591) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.
Western Blot: HIST1H2AB Antibody (1P5B6) [NBP3-15591]

Western Blot: HIST1H2AB Antibody (1P5B6) [NBP3-15591]

Western Blot: HIST1H2AB Antibody (1P5B6) [NBP3-15591] - Western blot analysis of extracts of various cell lines, using HIST1H2AB Rabbit mAb (NBP3-15591) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Immunoprecipitation: HIST1H2AB Antibody (1P5B6) [NBP3-15591]

Immunoprecipitation: HIST1H2AB Antibody (1P5B6) [NBP3-15591]

Immunoprecipitation: HIST1H2AB Antibody (1P5B6) [NBP3-15591] - Immunoprecipitation analysis of 300ug extracts of HeLa cells using 3ug HIST1H2AB antibody (NBP3-15591). Western blot was performed from the immunoprecipitate using HIST1H2AB antibody (NBP3-15591) at a dilition of 1:1000.
HIST1H2AB Antibody (1P5B6)

Immunohistochemistry: HIST1H2AB Antibody (1P5B6) [HIST1H2AB] -

Immunohistochemistry: HIST1H2AB Antibody (1P5B6) [HIST1H2AB] - Immunohistochemistry analysis of paraffin-embedded Human breast using HIST1H2AB Rabbit mAb at dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
HIST1H2AB Antibody (1P5B6)

Immunohistochemistry: HIST1H2AB Antibody (1P5B6) [HIST1H2AB] -

Immunohistochemistry: HIST1H2AB Antibody (1P5B6) [HIST1H2AB] - Immunohistochemistry analysis of paraffin-embedded Mouse spleen using HIST1H2AB Rabbit mAb at dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
HIST1H2AB Antibody (1P5B6)

Immunohistochemistry: HIST1H2AB Antibody (1P5B6) [HIST1H2AB] -

Immunohistochemistry: HIST1H2AB Antibody (1P5B6) [HIST1H2AB] - Immunohistochemistry analysis of paraffin-embedded Rat liver using HIST1H2AB Rabbit mAb at dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
HIST1H2AB Antibody (1P5B6)

Immunohistochemistry: HIST1H2AB Antibody (1P5B6) [HIST1H2AB] -

Immunohistochemistry: HIST1H2AB Antibody (1P5B6) [HIST1H2AB] - Immunohistochemistry analysis of paraffin-embedded Human colon using HIST1H2AB Rabbit mAb at dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
HIST1H2AB Antibody (1P5B6)

Immunohistochemistry: HIST1H2AB Antibody (1P5B6) [HIST1H2AB] -

Immunohistochemistry: HIST1H2AB Antibody (1P5B6) [HIST1H2AB] - Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer using HIST1H2AB Rabbit mAb at dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
HIST1H2AB Antibody (1P5B6)

Immunohistochemistry: HIST1H2AB Antibody (1P5B6) [HIST1H2AB] -

Immunohistochemistry: HIST1H2AB Antibody (1P5B6) [HIST1H2AB] - Immunohistochemistry analysis of paraffin-embedded Rat colon using HIST1H2AB Rabbit mAb at dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
HIST1H2AB Antibody (1P5B6)

Immunohistochemistry: HIST1H2AB Antibody (1P5B6) [HIST1H2AB] -

Immunohistochemistry: HIST1H2AB Antibody (1P5B6) [HIST1H2AB] - Immunohistochemistry analysis of paraffin-embedded Human brain using HIST1H2AB Rabbit mAb at dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Applications for HIST1H2AB Antibody (1P5B6)

Application
Recommended Usage

Immunohistochemistry

1:100 - 1:500

Immunohistochemistry-Paraffin

1:100 - 1:500

Immunoprecipitation

1:100 - 1:500

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: HIST1H2AB

HIST1H2AB is 130 amino acids long, weighs approximately 14 kDa, and is part of a group of basic nuclear proteins called histones, which are responsible for nucleosome structure of the chromosomal fiber in eukaryotes. Current studies are being done on several diseases and disorders including riddle syndrome, systemic lupus erythematosus, lupus erythematosus, cockayne syndrome, hemochromatosis, and immunodeficiency. HIST1H2AB has also been shown to have interactions with HIST1H4A, HIST1H4B, HIST1H4C, HIST1H4D, and HIST1H4E in pathways such as the proteasome degradation, telomere maintenance, nucleosome assembly, cell cycle, and systemic lupus erythematosus pathways.

Alternate Names

H2A/m, H2AFM, histone cluster 1, H2ab, histone H2A type 1-B/E

Gene Symbol

H2AC4

Additional HIST1H2AB Products

Product Documents for HIST1H2AB Antibody (1P5B6)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for HIST1H2AB Antibody (1P5B6)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HIST1H2AB Antibody (1P5B6)

There are currently no reviews for this product. Be the first to review HIST1H2AB Antibody (1P5B6) and earn rewards!

Have you used HIST1H2AB Antibody (1P5B6)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies