Histone H2AX is one of a number of core histone proteins. In the cellular response to genotoxic insults, ATM and related protein kinases phosphorylate the carboxyl-terminal tail of the H2AX protein (gamma-H2AX). gamma-H2AX marks the site of damage and provides a nucleation site for the formation of damage response and repair complexes. BRCA1 carboxyl terminal (BRCT) domain-containing proteins are recruited to gamma-H2AX to create a protein scaffold for further assembly of signaling complexes.
Histone H2AX Antibody - BSA Free
Novus Biologicals | Catalog # NBP3-04113
![Western Blot: Histone H2AX AntibodyBSA Free [NBP3-04113]](https://beta-resources.rndsystems.com/images/products/Histone-H2AX-Antibody-Western-Blot-NBP3-04113-img0003.jpg "Western Blot: Histone H2AX AntibodyBSA Free [NBP3-04113]")
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-143 of human Histone H2AX (NP_002096.1). MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGK
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
15 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Description
Novus Biologicals Rabbit Histone H2AX Antibody - BSA Free (NBP3-04113) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
Scientific Data Images for Histone H2AX Antibody - BSA Free
Western Blot: Histone H2AX AntibodyBSA Free [NBP3-04113]
Western Blot: Histone H2AX Antibody [NBP3-04113] - Analysis of extracts of various cell lines, using Histone H2Ax antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.
Immunocytochemistry/ Immunofluorescence: Histone H2AX Antibody - BSA Free [Histone H2AX] -
Immunocytochemistry/ Immunofluorescence: Histone H2AX Antibody - BSA Free [Histone H2AX] - Confocal immunofluorescence analysis of HeLa cells using Histone H2AX Rabbit pAb at dilution of 1:200. Blue: DAPI for nuclear staining.
Immunohistochemistry: Histone H2AX Antibody - BSA Free [Histone H2AX] -
Immunohistochemistry: Histone H2AX Antibody - BSA Free [Histone H2AX] - Immunohistochemistry analysis of paraffin-embedded Rat heart using Histone H2AX Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Immunohistochemistry: Histone H2AX Antibody - BSA Free [Histone H2AX] -
Immunohistochemistry: Histone H2AX Antibody - BSA Free [Histone H2AX] - Immunohistochemistry analysis of paraffin-embedded Mouse brain using Histone H2AX Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Immunohistochemistry: Histone H2AX Antibody - BSA Free [Histone H2AX] -
Immunohistochemistry: Histone H2AX Antibody - BSA Free [Histone H2AX] - Immunohistochemistry analysis of paraffin-embedded Rat brain using Histone H2AX Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Western Blot: Histone H2AX Antibody - BSA Free [Histone H2AX] -
Western Blot: Histone H2AX Antibody - BSA Free [Histone H2AX] - Western blot analysis of various lysates using Histone H2AX Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.
Applications for Histone H2AX Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
1:50-1:100
Immunohistochemistry
1:50-1:100
Western Blot
1:500-1:1000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: Histone H2AX
Alternate Names
H2AFX
Gene Symbol
H2AX
Additional Histone H2AX Products
Product Documents for Histone H2AX Antibody - BSA Free
Product Specific Notices for Histone H2AX Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for Histone H2AX Antibody - BSA Free
There are currently no reviews for this product. Be the first to review Histone H2AX Antibody - BSA Free and earn rewards!
Have you used Histone H2AX Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...