HMGN1/HMG14 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-03219

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human HMGN1/HMG14 (NP_004956.5). MPKRKVSSAEGAAKEEPKRRSARLSAKPPAKVEAKPKKAAAKDKSSDKKVQTKGKRGAKGKQAEVANQETKEDLPAENGETKTEESPASDEAGEKEAKSD

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

10 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for HMGN1/HMG14 Antibody - BSA Free

Immunohistochemistry-Paraffin: HMGN1/HMG14 Antibody - BSA Free [NBP3-03219]

Immunohistochemistry-Paraffin: HMGN1/HMG14 Antibody - BSA Free [NBP3-03219]

Immunohistochemistry-Paraffin: HMGN1/HMG14 Antibody [NBP3-03219] - Immunohistochemistry of paraffin-embedded rat brain using HMGN1/HMG14 antibody (NBP3-03219) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: HMGN1/HMG14 Antibody - BSA Free [NBP3-03219]

Immunohistochemistry-Paraffin: HMGN1/HMG14 Antibody - BSA Free [NBP3-03219]

Immunohistochemistry-Paraffin: HMGN1/HMG14 Antibody [NBP3-03219] - Immunohistochemistry of paraffin-embedded mouse testis using HMGN1/HMG14 antibody (NBP3-03219) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Applications for HMGN1/HMG14 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50-1:200

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: HMGN1

HMGNs are proteins that bind chromatin effectively reducing the compaction of the chromatin fiber and enhancing access to DNA regulatory sequences. Members of this family have a conserved chromatin binding domain which is phosphorylated during mitosis. The sequence immunized is conserved in several species. As such, this reagent is designed as a universal reagent for the detection of all phosphorylated HMGN proteins. The High Mobility Group (HMG) proteins were originally isolated from mammalian cells and were named according to their electrophoretic mobility in polyacrylamide gels. HMGs were arbitrarily classed as a specific type of nonhistone proteins based on the observation that they are ubiquitous to mammalian cells, that they share certain physical properties, and that they are associated with isolated chromatin. HMG proteins and are now subdivided into 3 families: the HMGB (formerly HMG-1/-2) family, the HMGN (formerly HMG-14/-17) family, and the HMGA (formerly HMG-I/Y/C) family. Each HMG family has a characteristic functional sequence motif. The functional motif of the HMGB family is called the "HMG-box;" that of the HMGN family, the "nucleosomal binding domain;" and that of the HMGA family, the "AT-hook." The functional motifs characteristic of these canonical HMGs are widespread among nuclear proteins in a variety of organisms. Proteins containing any of these functional motifs embedded in their sequence are known as "HMG motif proteins."

Long Name

High Mobility Group Nucleosome Binding Domain 1

Alternate Names

HMG14

Gene Symbol

HMGN1

Additional HMGN1 Products

Product Documents for HMGN1/HMG14 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HMGN1/HMG14 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HMGN1/HMG14 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HMGN1/HMG14 Antibody - BSA Free and earn rewards!

Have you used HMGN1/HMG14 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...