hnRNP K Antibody (3O5Y4)

Novus Biologicals | Catalog # NBP3-15303

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 3O5Y4 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human hnRNP K (P61978). METEQPEETFPNTETNGEFGKRPAEDMEEEQAFKRSRNTDEMVELRILLQSKNAGAVIGKGGKNIKALRTDYNASVSVPDSSGPERILSISADIETIGEI

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for hnRNP K Antibody (3O5Y4)

Western Blot: hnRNP K Antibody (3O5Y4) [NBP3-15303]

Western Blot: hnRNP K Antibody (3O5Y4) [NBP3-15303]

Western Blot: hnRNP K Antibody (3O5Y4) [NBP3-15303] - Western blot analysis of extracts of various cell lines, using hnRNP K antibody (NBP3-15303) at 1:2000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Immunocytochemistry/ Immunofluorescence: hnRNP K Antibody (3O5Y4) [NBP3-15303]

Immunocytochemistry/ Immunofluorescence: hnRNP K Antibody (3O5Y4) [NBP3-15303]

Immunocytochemistry/Immunofluorescence: hnRNP K Antibody (3O5Y4) [NBP3-15303] - Immunofluorescence analysis of U-2 OS cells using hnRNP K Rabbit mAb (NBP3-15303) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: hnRNP K Antibody (3O5Y4) [NBP3-15303]

Immunohistochemistry-Paraffin: hnRNP K Antibody (3O5Y4) [NBP3-15303]

Immunohistochemistry-Paraffin: hnRNP K Antibody (3O5Y4) [NBP3-15303] - Immunohistochemistry of paraffin-embedded mouse brain using hnRNP K Rabbit mAb (NBP3-15303) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunocytochemistry/ Immunofluorescence: hnRNP K Antibody (3O5Y4) [NBP3-15303]

Immunocytochemistry/ Immunofluorescence: hnRNP K Antibody (3O5Y4) [NBP3-15303]

Immunocytochemistry/Immunofluorescence: hnRNP K Antibody (3O5Y4) [NBP3-15303] - Immunofluorescence analysis of C6 cells using hnRNP K Rabbit mAb (NBP3-15303) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: hnRNP K Antibody (3O5Y4) [NBP3-15303]

Immunocytochemistry/ Immunofluorescence: hnRNP K Antibody (3O5Y4) [NBP3-15303]

Immunocytochemistry/Immunofluorescence: hnRNP K Antibody (3O5Y4) [NBP3-15303] - Immunofluorescence analysis of NIH-3T3 cells using hnRNP K Rabbit mAb (NBP3-15303) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: hnRNP K Antibody (3O5Y4) [NBP3-15303]

Immunohistochemistry-Paraffin: hnRNP K Antibody (3O5Y4) [NBP3-15303]

Immunohistochemistry-Paraffin: hnRNP K Antibody (3O5Y4) [NBP3-15303] - Immunohistochemistry of paraffin-embedded rat brain using hnRNP K Rabbit mAb (NBP3-15303) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: hnRNP K Antibody (3O5Y4) [NBP3-15303]

Immunohistochemistry-Paraffin: hnRNP K Antibody (3O5Y4) [NBP3-15303]

Immunohistochemistry-Paraffin: hnRNP K Antibody (3O5Y4) [NBP3-15303] - Immunohistochemistry of paraffin-embedded human esophageal using hnRNP K Rabbit mAb (NBP3-15303) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
hnRNP K Antibody (3O5Y4)

Immunohistochemistry: hnRNP K Antibody (3O5Y4) [NBP3-15303] -

Immunohistochemistry: hnRNP K Antibody (3O5Y4) [NBP3-15303] - Immunohistochemistry analysis of hnRNP K in paraffin-embedded Human lung adenocarcinoma tissue using hnRNP K Rabbit mAb at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
hnRNP K Antibody (3O5Y4)

Immunohistochemistry: hnRNP K Antibody (3O5Y4) [NBP3-15303] -

Immunohistochemistry: hnRNP K Antibody (3O5Y4) [NBP3-15303] - Immunohistochemistry analysis of hnRNP K in paraffin-embedded human colon tissue using hnRNP K Rabbit mAb at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
hnRNP K Antibody (3O5Y4)

Immunohistochemistry: hnRNP K Antibody (3O5Y4) [NBP3-15303] -

Immunohistochemistry: hnRNP K Antibody (3O5Y4) [NBP3-15303] - Immunohistochemistry analysis of hnRNP K in paraffin-embedded mouse testis tissue using hnRNP K Rabbit mAb at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
hnRNP K Antibody (3O5Y4)

Immunohistochemistry: hnRNP K Antibody (3O5Y4) [NBP3-15303] -

Immunohistochemistry: hnRNP K Antibody (3O5Y4) [NBP3-15303] - Immunohistochemistry analysis of hnRNP K in paraffin-embedded rat colon tissue using hnRNP K Rabbit mAb at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
hnRNP K Antibody (3O5Y4)

Immunohistochemistry: hnRNP K Antibody (3O5Y4) [NBP3-15303] -

Immunohistochemistry: hnRNP K Antibody (3O5Y4) [NBP3-15303] - Immunohistochemistry analysis of hnRNP K in paraffin-embedded mouse liver tissue using hnRNP K Rabbit mAb at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
hnRNP K Antibody (3O5Y4)

Immunohistochemistry: hnRNP K Antibody (3O5Y4) [NBP3-15303] -

Immunohistochemistry: hnRNP K Antibody (3O5Y4) [NBP3-15303] - Immunohistochemistry analysis of hnRNP K in paraffin-embedded human tonsil tissue using hnRNP K Rabbit mAb at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
hnRNP K Antibody (3O5Y4)

Immunohistochemistry: hnRNP K Antibody (3O5Y4) [NBP3-15303] -

Immunohistochemistry: hnRNP K Antibody (3O5Y4) [NBP3-15303] - Immunohistochemistry analysis of hnRNP K in paraffin-embedded human cervix cancer tissue using hnRNP K Rabbit mAb at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
hnRNP K Antibody (3O5Y4)

Immunohistochemistry: hnRNP K Antibody (3O5Y4) [NBP3-15303] -

Immunohistochemistry: hnRNP K Antibody (3O5Y4) [NBP3-15303] - Immunohistochemistry analysis of hnRNP K in paraffin-embedded mouse colon tissue using hnRNP K Rabbit mAb at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
hnRNP K Antibody (3O5Y4)

Immunohistochemistry: hnRNP K Antibody (3O5Y4) [NBP3-15303] -

Immunohistochemistry: hnRNP K Antibody (3O5Y4) [NBP3-15303] - Immunohistochemistry analysis of hnRNP K in paraffin-embedded mouse spleen tissue using hnRNP K Rabbit mAb at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
hnRNP K Antibody (3O5Y4)

Immunocytochemistry/ Immunofluorescence: hnRNP K Antibody (3O5Y4) [NBP3-15303] -

Immunocytochemistry/ Immunofluorescence: hnRNP K Antibody (3O5Y4) [NBP3-15303] - Confocal imaging of U-2 0S cells using hnRNP K Rabbit mAb. The cells were counterstained with alpha-Tubulin Mouse mAb (Green). DAPI was used for nuclear staining (blue). Objective: 60x.
hnRNP K Antibody (3O5Y4)

Immunohistochemistry: hnRNP K Antibody (3O5Y4) [NBP3-15303] -

Immunohistochemistry: hnRNP K Antibody (3O5Y4) [NBP3-15303] - Immunohistochemistry analysis of hnRNP K in paraffin-embedded rat spleen tissue using hnRNP K Rabbit mAb at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Applications for hnRNP K Antibody (3O5Y4)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: hnRNP K

The hnRNP-K family of acidic nuclear proteins has been identified using a monoclonal antibody that distinguishes between quiescent and proliferating human keratinocytes. The family, which is composed of four major proteins (hnRNPs-K A, B, C and D) and their modified forms, is present in similar overall levels in quiescent and proliferating normal keratinocytes although clear differences were observed in the levels of some of the individual variants (1). hnRNP-K is an ancient RNA/DNA-binding protein that is involved in multiple processes that compose gene expression. The pleiotropic action of K protein reflects its ability to interact with different classes of factors, interactions that are regulated by extracellular signals (2). hnRNP-K has several different cellular roles including transcription, mRNA shuttling, RNA editing and translation. Several reports implicate hnRNP K having a role in tumorigenesis, for instance hnRNP K increases transcription of the oncogene c-myc and hnRNP K expression is regulated by the p53/MDM 2 pathway (3).

Alternate Names

dC-stretch binding protein, FLJ41122, heterogeneous nuclear ribonucleoprotein K, hnRNP K, transformation upregulated nuclear protein, Transformation up-regulated nuclear protein, TUNPHNRPKCSBP

Gene Symbol

HNRNPK

Additional hnRNP K Products

Product Documents for hnRNP K Antibody (3O5Y4)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for hnRNP K Antibody (3O5Y4)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for hnRNP K Antibody (3O5Y4)

There are currently no reviews for this product. Be the first to review hnRNP K Antibody (3O5Y4) and earn rewards!

Have you used hnRNP K Antibody (3O5Y4)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...