HNRPA3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-80486

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all HNRPA3 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the N terminal of human HNRPA3. Peptide sequence MEVKPPPGRPQPDSGRRRRRRGEEGHDPKEPEQLRKLFIGGLSFETTDDS. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for HNRPA3 Antibody - BSA Free

Western Blot: HNRPA3 Antibody [NBP1-80486]

Western Blot: HNRPA3 Antibody [NBP1-80486]

Western Blot: HNRPA3 Antibody [NBP1-80486] - Host: Rabbit. Target: HNRNPA3. Positive control (+): HeLa Cell Lysate (HL). Negative control (-): Human Fetal Heart (HE). Antibody concentration: 3ug/ml
Immunohistochemistry: HNRPA3 Antibody [NBP1-80486]

Immunohistochemistry: HNRPA3 Antibody [NBP1-80486]

Immunohistochemistry: HNRPA3 Antibody [NBP1-80486] - Human Liver Cellular data: Hepatocytes Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.
Western Blot: HNRPA3 Antibody [NBP1-80486]

Western Blot: HNRPA3 Antibody [NBP1-80486]

Western Blot: HNRPA3 Antibody [NBP1-80486] - Jurkat cell lysate, Antibody Titration: 1.25ug/ml
Western Blot: HNRPA3 Antibody [NBP1-80486]

Western Blot: HNRPA3 Antibody [NBP1-80486]

Western Blot: HNRPA3 Antibody [NBP1-80486] - Sample Tissue: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 0.625ug/mL, Peptide Concentration: 1.0ug/mL, Lysate Quantity: 25ug/lane, Gel Concentration: 12%
Western Blot: HNRPA3 Antibody [NBP1-80486]

Western Blot: HNRPA3 Antibody [NBP1-80486]

Western Blot: HNRPA3 Antibody [NBP1-80486] - Antibody Titration: 1 ug/ml Human 721_B.
Western Blot: HNRPA3 Antibody [NBP1-80486]

Western Blot: HNRPA3 Antibody [NBP1-80486]

Western Blot: HNRPA3 Antibody [NBP1-80486] - Antibody Titration: 1 ug/ml Human Daudi.
Western Blot: HNRPA3 Antibody [NBP1-80486]

Western Blot: HNRPA3 Antibody [NBP1-80486]

Western Blot: HNRPA3 Antibody [NBP1-80486] - Sample Tissue: Human Jurkat Antibody Dilution: 1.0 ug/ml
Immunohistochemistry-Paraffin: HNRPA3 Antibody [NBP1-80486]

Immunohistochemistry-Paraffin: HNRPA3 Antibody [NBP1-80486]

Immunohistochemistry-Paraffin: HNRPA3 Antibody [NBP1-80486] - Human Liver Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Hepatocytes (indicated with arrows) 400X magnification.

Applications for HNRPA3 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HNRPA3

HNRPA3 plays a role in cytoplasmic trafficking of RNA. Binds to the cis-acting response element, A2RE. May beinvolved in pre-mRNA splicing

Alternate Names

heterogeneous nuclear ribonucleoprotein A3

Gene Symbol

HNRNPA3

UniProt

NP_919223 (Human)

Additional HNRPA3 Products

Product Documents for HNRPA3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for HNRPA3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HNRPA3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HNRPA3 Antibody - BSA Free and earn rewards!

Have you used HNRPA3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies