HO-2/HMOX2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-91981

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MERNKDHPAFAPLYFPMELHRKEALTKDMEYFFGENWEEQVQCPKAAQKYVERIHYIGQNEPEL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for HO-2/HMOX2 Antibody - BSA Free

Western Blot: HO-2/HMOX2 Antibody [NBP1-91981]

Western Blot: HO-2/HMOX2 Antibody [NBP1-91981]

Western Blot: HO-2/HMOX2 Antibody [NBP1-91981] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: HO-2/HMOX2 Antibody [NBP1-91981]

Immunohistochemistry-Paraffin: HO-2/HMOX2 Antibody [NBP1-91981]

Immunohistochemistry-Paraffin: HO-2/HMOX2 Antibody [NBP1-91981] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.
Western Blot: HO-2/HMOX2 Antibody [NBP1-91981]

Western Blot: HO-2/HMOX2 Antibody [NBP1-91981]

Western Blot: HO-2/HMOX2 Antibody [NBP1-91981] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
HO-2/HMOX2 Antibody - BSA Free Immunohistochemistry: HO-2/HMOX2 Antibody - BSA Free [NBP1-91981]

Immunohistochemistry: HO-2/HMOX2 Antibody - BSA Free [NBP1-91981]

Staining of human tonsil shows moderate granular cytoplasmic positivity in non-germinal center cells.
HO-2/HMOX2 Antibody - BSA Free Immunohistochemistry: HO-2/HMOX2 Antibody - BSA Free [NBP1-91981]

Immunohistochemistry: HO-2/HMOX2 Antibody - BSA Free [NBP1-91981]

Staining of human testis shows strong granular cytoplasmic positivity in cells in seminiferous ducts.
HO-2/HMOX2 Antibody - BSA Free Western Blot: HO-2/HMOX2 Antibody - BSA Free [NBP1-91981]

Western Blot: HO-2/HMOX2 Antibody - BSA Free [NBP1-91981]

Analysis in human cell line U-2197.
HO-2/HMOX2 Antibody - BSA Free Immunohistochemistry: HO-2/HMOX2 Antibody - BSA Free [NBP1-91981]

Immunohistochemistry: HO-2/HMOX2 Antibody - BSA Free [NBP1-91981]

Staining of human cerebral cortex shows moderate granular cytoplasmic positivity in glial cells.
HO-2/HMOX2 Antibody - BSA Free Immunohistochemistry: HO-2/HMOX2 Antibody - BSA Free [NBP1-91981]

Immunohistochemistry: HO-2/HMOX2 Antibody - BSA Free [NBP1-91981]

Staining of human colon shows strong granular cytoplasmic positivity in glandular cells.

Applications for HO-2/HMOX2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HO-2/HMOX2

Heme oxygenase, an essential enzyme in heme catabolism, cleaves heme to form biliverdin, which is subsequently converted to bilirubin by biliverdin reductase, and carbon monoxide, a putative neurotransmitter. Heme oxygenase activity is induced by its substrate heme and by various nonheme substances. Heme oxygenase occurs as 2 isozymes, an inducible heme oxygenase-1 and a constitutive heme oxygenase-2. HMOX1 and HMOX2 belong to the heme oxygenase family. Alternative splice variants encoding the same protein have been identified at this locus.

Long Name

Heme Oxygenase 2

Alternate Names

HMOX2, HO2

Gene Symbol

HMOX2

Additional HO-2/HMOX2 Products

Product Documents for HO-2/HMOX2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HO-2/HMOX2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HO-2/HMOX2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HO-2/HMOX2 Antibody - BSA Free and earn rewards!

Have you used HO-2/HMOX2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...