HspA12B Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-88293

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: QLLDLSGRAPGGGRLGERRSIDSSFRQAREQLRRSRHSRTFLVESGVGELWAEMQAGDRYVVA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for HspA12B Antibody - BSA Free

HspA12B Antibody - BSA Free Western Blot: HspA12B Antibody - BSA Free [NBP1-88293]

Western Blot: HspA12B Antibody - BSA Free [NBP1-88293]

Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
HspA12B Antibody - BSA Free Immunohistochemistry-Paraffin: HspA12B Antibody - BSA Free [NBP1-88293]

Immunohistochemistry-Paraffin: HspA12B Antibody - BSA Free [NBP1-88293]

Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.
HspA12B Antibody - BSA Free Immunohistochemistry-Paraffin: HspA12B Antibody - BSA Free [NBP1-88293]

Immunohistochemistry-Paraffin: HspA12B Antibody - BSA Free [NBP1-88293]

Staining of human kidney shows moderate cytoplasmic positivity in cells in glomeruli.
HspA12B Antibody - BSA Free Immunohistochemistry-Paraffin: HspA12B Antibody - BSA Free [NBP1-88293]

Immunohistochemistry-Paraffin: HspA12B Antibody - BSA Free [NBP1-88293]

Staining of human cerebral cortex shows strong positivity in endothelial cells.
HspA12B Antibody - BSA Free Immunohistochemistry-Paraffin: HspA12B Antibody - BSA Free [NBP1-88293]

Immunohistochemistry-Paraffin: HspA12B Antibody - BSA Free [NBP1-88293]

Staining of human tonsil shows no positivity in germinal center cells as expected.

Applications for HspA12B Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HspA12B

HSPA12B is encoded by this gene contains an atypical heat shock protein 70 (Hsp70) ATPase domain and is therefore a distant member of the mammalian Hsp70 family. This gene may be involved in susceptibility to atherosclerosis. [provided by RefSeq].

Alternate Names

C20orf60, chromosome 20 open reading frame 60, dJ1009E24.2, FLJ32150, heat shock 70 kDa protein 12B, heat shock 70kD protein 12B, MGC131912

Gene Symbol

HSPA12B

Additional HspA12B Products

Product Documents for HspA12B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HspA12B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for HspA12B Antibody - BSA Free

Customer Reviews for HspA12B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HspA12B Antibody - BSA Free and earn rewards!

Have you used HspA12B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...