IGFBP-4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-80549

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human, Mouse

Cited:

Mouse

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Immunohistochemistry-Frozen

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptide directed towards the middle region of human IGFBP4. Peptide sequence RALERLAASQSRTHEDLYIIPIPNCDRNGNFHPKQCHPALDGQRGKCWCV. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for IGFBP-4 Antibody - BSA Free

Western Blot: IGFBP-4 Antibody [NBP1-80549]

Western Blot: IGFBP-4 Antibody [NBP1-80549]

Western Blot: IGFBP-4 Antibody [NBP1-80549] - Host: Mouse. Target Name: IGFBP4. Sample Tissue: Mouse Brain. Antibody Dilution: 1ug/ml
Immunocytochemistry/ Immunofluorescence: IGFBP-4 Antibody [NBP1-80549]

Immunocytochemistry/ Immunofluorescence: IGFBP-4 Antibody [NBP1-80549]

IGFBP-4-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-80549-img0006.jpg
Immunohistochemistry-Paraffin: IGFBP-4 Antibody [NBP1-80549]

Immunohistochemistry-Paraffin: IGFBP-4 Antibody [NBP1-80549]

Immunohistochemistry-Paraffin: IGFBP-4 Antibody [NBP1-80549] - Human Prostate Tissue, 5.0ug/ml.
Western Blot: IGFBP-4 Antibody [NBP1-80549]

Western Blot: IGFBP-4 Antibody [NBP1-80549]

Western Blot: IGFBP-4 Antibody [NBP1-80549] - Human Fetal Brain Lysate, concentration 1 ug/ml.
Western Blot: IGFBP-4 Antibody [NBP1-80549]

Western Blot: IGFBP-4 Antibody [NBP1-80549]

Western Blot: IGFBP-4 Antibody [NBP1-80549] - Host: Rabbit. Target Name: IGFBP4. Sample Tissue: Human MDA-MB-435s Whole Cell. Antibody Dilution: 1ug/ml
Immunocytochemistry/ Immunofluorescence: IGFBP-4 Antibody [NBP1-80549]

Immunocytochemistry/ Immunofluorescence: IGFBP-4 Antibody [NBP1-80549]

Immunocytochemistry/Immunofluorescence: IGFBP-4 Antibody [NBP1-80549] - Mouse uterus stained with at a dilution of 1:1000. HIER is applied using citrate buffer pH6. Image from verified customer review.
IGFBP-4 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: IGFBP-4 Antibody - BSA Free [NBP1-80549] -

Rac1 regulates vesicular exocytosis in decidual cells by controlling Rab27b.(A & B) Expression of Rab27b mRNA and protein is downregulated in Rac1-null stromal cells. (A) qPCR was performed to monitor the expression of Rab27a and Rab27b in the uteri of Rac1f/f and Rac1d/d mice on day 8 of pregnancy. Data represent mean +/- SEM from four separate samples and were analyzed by t-test. Asterisks indicate statistically significant differences (***P < 0.001). (B) IF of RAB27B in Rac1f/f and Rac1d/d uteri on day 8 of pregnancy. AMD, MD, and E denote antimesometrial decidua, mesometrial decidua, and embryo respectively. (C & D) Secretions by decidual cells are reduced in the conditioned media of Rac1-null stromal cells. Stromal cells isolated from Rac1f/f and Rac1d/d uteri on day 4 of pregnancy were cultured for 96 hours, fixed and subjected to IF using VEGFA (C, Left) and IGFBP4 (D, Left) antibodies. Conditioned media from cultured stromal cells isolated from Rac1f/f and Rac1d/d uteri were analyzed for VEGFA (C, Right) and IGFBP4 (D, Right) by ELISA. Data represent mean +/- SEM from three separate samples and were analyzed by two-way ANOVA with Bonferroni post-test. Asterisks indicate statistically significant differences (*P < 0.05, **P < 0.01, and ***P < 0.001). Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/26305333), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for IGFBP-4 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:10-1:500

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml
Application Notes
Use in Immunohistochemistry-Frozen reported in scientific literature (PMID: 26305333).

Reviewed Applications

Read 1 review rated 5 using NBP1-80549 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: IGFBP-4

IGFBP4 is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein binds both insulin-like growth factors (IGFs) I and II and circulates in the plasma in both glycosylated and non-glycosylated forms. Binding of this protein prolongs the half-life of the IGFs and alters their interaction with cell surface receptors. [provided by RefSeq]

Long Name

Insulin-like Growth Factor Binding Protein 4

Alternate Names

IGFBP4

Gene Symbol

IGFBP4

Additional IGFBP-4 Products

Product Documents for IGFBP-4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for IGFBP-4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for IGFBP-4 Antibody - BSA Free

Customer Reviews for IGFBP-4 Antibody - BSA Free (1)

5 out of 5
1 Customer Rating
5 Stars
100%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used IGFBP-4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 11 review Showing All
Filter By:
  • IGFBP-4 Antibody
    Name: Anonymous
    Application: Immunocytochemistry/Immunofluorescence
    Sample Tested: mouse uterus
    Species: Mouse
    Verified Customer | Posted 11/16/2016
    Used IF with Alexa fluor 488 as secondary antibody and used 1:1000 dilution of primary antibody. HIER is applied using citrate buffer pH6.
    IGFBP-4 Antibody - BSA Free NBP1-80549

There are no reviews that match your criteria.

Showing  1 - 11 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...