IL-36 beta/IL-1F8 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-83892

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: PKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKDLCLFCAEIQGKP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for IL-36 beta/IL-1F8 Antibody - BSA Free

Immunohistochemistry-Paraffin: IL-36 beta/IL-1F8 Antibody [NBP1-83892]

Immunohistochemistry-Paraffin: IL-36 beta/IL-1F8 Antibody [NBP1-83892]

Immunohistochemistry-Paraffin: IL-36 beta/IL-1F8 Antibody [NBP1-83892] - Staining of human placenta shows distinct membranous and cytoplasmic positivity in decidua cells.
IL-36 beta/IL-1F8 Antibody - BSA Free Western Blot: IL-36 beta/IL-1F8 Antibody - BSA Free [NBP1-83892]

Western Blot: IL-36 beta/IL-1F8 Antibody - BSA Free [NBP1-83892]

Analysis in control (vector only transfected HEK293T lysate) and IL36B over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

Applications for IL-36 beta/IL-1F8 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: IL-36 beta/IL-1F8

Interleukin 36 beta (IL-36 beta), also known as IL-1F8, FIL-1h and IL-1H2, is a member of the IL-1 family of proteins. IL-36 beta is reported to be actively secreted. Cells expressing IL-36 beta include resting and activated monocytes, and B cells. The receptor for IL-36 beta is thought to be a combination of IL-1 Rrp2 and IL-1 RAcP. Recombinant IL-36 beta activates pathways involving NF-kB and MAPK in an IL-1 Rrp2-dependent manner.

Long Name

Interleukin 36 beta/Interleukin 1 Family 8

Alternate Names

FIL1 eta, IL-1 eta, IL-1H2, IL1F8, IL36 beta, IL36B

Gene Symbol

IL36B

Additional IL-36 beta/IL-1F8 Products

Product Documents for IL-36 beta/IL-1F8 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for IL-36 beta/IL-1F8 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for IL-36 beta/IL-1F8 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review IL-36 beta/IL-1F8 Antibody - BSA Free and earn rewards!

Have you used IL-36 beta/IL-1F8 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for IL-36 beta/IL-1F8 Antibody - BSA Free

Showing  1 - 11 FAQ Showing All
  • Q: We recently purchased a vial of IL1F8 Antibody (NBP1-83892), lot R32798. The concentration is not listed, and I was wondering if you could provide me with that information?

    A: The concentration for Lot: R32798 is 0.1mg/ml.

Showing  1 - 11 FAQ Showing All
View all FAQs for Antibodies
Loading...

Associated Pathways

IL-1 Family Signaling Pathways IL-1 Family Signaling Pathway Thumbnail