Integrin alpha 3B Antibody (PB36) [Alexa Fluor™ Plus 594]

Novus Biologicals | Catalog # NBP1-97731AFP594

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Frozen, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Alexa Fluor Plus 594 (Excitation = 590 nm, Emission = 618 nm)

Antibody Source

Monoclonal Mouse IgG1 Clone # PB36
Loading...

Product Specifications

Immunogen

Derived by fusion of SP2/0 Mouse myeloma cells with spleen cells from a BALB/c Mouse immunized with a synthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of Integrin alpha 3Bincluding an appending N-terminal cysteine (CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK) coupled to keyhole limpet hemocyanin.

Reactivity Notes

A broad species reactivity is expected based on the conserved nature of the epitope.

Specificity

This antibody recognizes the cytoplasmic domain of integrin subunits Integrin alpha 3B and Integrin alpha 6B. It reacts with the basement membrane zone and endothelial cells in skin, tubuli in kidney and all vascular and capillary endothelia in brain and heart.

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1

Applications for Integrin alpha 3B Antibody (PB36) [Alexa Fluor™ Plus 594]

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

Optimal dilutions of this antibody should be experimentally determined.

Immunohistochemistry

Optimal dilutions of this antibody should be experimentally determined.

Immunohistochemistry-Frozen

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Protein A or G purified

Formulation

50mM Sodium Borate

Preservative

0.05% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C in the dark.

Background: Integrin alpha 3B

Alternate Names

AA407068, CD49C, GAPB3, integrin alpha 3

Gene Symbol

ITGA3

Additional Integrin alpha 3B Products

Product Documents for Integrin alpha 3B Antibody (PB36) [Alexa Fluor™ Plus 594]

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Integrin alpha 3B Antibody (PB36) [Alexa Fluor™ Plus 594]



This product is provided under an intellectual property license from Life Technologies Corporation. The transfer of this product is conditioned on the buyer using the purchased product solely in research conducted by the buyer, excluding contract research or any fee for service research, and the buyer must not (1) use this product or its components for (a) diagnostic, therapeutic or prophylactic purposes; (b) testing, analysis or screening services, or information in return for compensation on a per-test basis; or (c) manufacturing or quality assurance or quality control, and/or (2) sell or transfer this product or its components for resale, whether or not resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5781 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@thermofisher.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Integrin alpha 3B Antibody (PB36) [Alexa Fluor™ Plus 594]

There are currently no reviews for this product. Be the first to review Integrin alpha 3B Antibody (PB36) [Alexa Fluor™ Plus 594] and earn rewards!

Have you used Integrin alpha 3B Antibody (PB36) [Alexa Fluor™ Plus 594]?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...