Integrin alpha 7 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-86118
Loading...
Key Product Details
Species Reactivity
Validated:
Human, Mouse, Bovine
Cited:
Mouse
Predicted:
Rat (91%). Backed by our 100% Guarantee.
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence
Cited:
IF/IHC
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FACPLSLEETDCYRVDIDQGADMQKESKENQWLGVSVRSQGPGGKIVTCAHRYEARQRVDQILETRDMIGRCFVLSQDLAIRDELDGGEWKFCE
Reactivity Notes
Use in Mouse reported in scientific literature (PMID:33686208). Bovine reactivity reported from a verified customer review.
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Description
Novus Biologicals Rabbit Integrin alpha 7 Antibody - BSA Free (NBP1-86118) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-Integrin alpha 7 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
Scientific Data Images for Integrin alpha 7 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: Integrin alpha 7 Antibody [NBP1-86118]
Immunocytochemistry/Immunofluorescence: Integrin alpha 7 Antibody [NBP1-86118] - Blue (Dapi), Red (Integrin alpha 7), Green (skeletal muscle Myosin). Mononucleated cells containing satellite cells and fibroblasts were isolated from bovine skeletal muscle tissue and induced for myogenic differentiation. Cells were fixed in methanol and stained using anti-myosin antibody and anti-Integrin a7 (#NBP1-86118) antibody. Corresponding secondary antibodies were used to visualize the result. Strong integrin a7 signal was observed in myotubes. But some weaker signals were also observed in fibroblasts which are known to be negative for it. Image submitted by a verified customer review.Immunohistochemistry-Paraffin: Integrin alpha 7 Antibody [NBP1-86118]
Immunohistochemistry-Paraffin: Integrin alpha 7 Antibody [NBP1-86118] - Staining of human heart muscle shows cytoplasmic and membranous positivity in myocytes.Immunocytochemistry/ Immunofluorescence: Integrin alpha 7 Antibody [NBP1-86118]
Immunocytochemistry/Immunofluorescence: Integrin alpha 7 Antibody [NBP1-86118] - Staining of human cell line U-2 OS shows localization to plasma membrane & cytosol. Antibody staining is shown in green.Applications for Integrin alpha 7 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:500 - 1:1000
Immunohistochemistry-Paraffin
1:500 - 1:1000
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Reviewed Applications
Read 1 review rated 4 using NBP1-86118 in the following applications:
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Integrin alpha 7
Alternate Names
ITGA7
Gene Symbol
ITGA7
Additional Integrin alpha 7 Products
Product Documents for Integrin alpha 7 Antibody - BSA Free
Product Specific Notices for Integrin alpha 7 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for Integrin alpha 7 Antibody - BSA Free
Customer Reviews for Integrin alpha 7 Antibody - BSA Free (1)
4 out of 5
1 Customer Rating
Have you used Integrin alpha 7 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Customer Images
Showing
1
-
1 的
1 review
Showing All
Filter By:
-
Application: ImmunocytochemistrySample Tested: skeletal muscle derived cellsSpecies: BovineVerified Customer | Posted 03/20/2018Blue (Dapi), Red (Integrin alpha 7), Green (skeletal muscle Myosin)Mononucleated cells containing satellite cells and fibroblasts were isolated from bovine skeletal muscle tissue and induced for myogenic differentiation. Cells were fixed in methanol and stained using anti-myosin antibody and anti-Integrin a7 (#NBP1-86118) antibody. Corresponding secondary antibodies were used to visualize the result. Strong integrin a7 signal was observed in myotubes. But some weaker signals were also observed in fibroblasts which are known to be negative for it.
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...