Kallikrein 8/Neuropsin Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-05517

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Kallikrein 8/Neuropsin Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: GSKVKPISLADHCTQPGQKCTVSGWGTVTSPRENFPDTLNCAEVKIFPQKKCEDAYPGQITDGMVCAGSSKGADTCEGDSGG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Kallikrein 8/Neuropsin Antibody - BSA Free

Immunohistochemistry-Paraffin: Kallikrein 8/Neuropsin Antibody [NBP3-05517]

Immunohistochemistry-Paraffin: Kallikrein 8/Neuropsin Antibody [NBP3-05517]

Immunohistochemistry-Paraffin: Kallikrein 8/Neuropsin Antibody [NBP3-05517] - Analysis in human esophagus and colon tissues using Anti-KLK8 antibody. Corresponding KLK8 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Kallikrein 8/Neuropsin Antibody [NBP3-05517]

Immunohistochemistry-Paraffin: Kallikrein 8/Neuropsin Antibody [NBP3-05517]

Immunohistochemistry-Paraffin: Kallikrein 8/Neuropsin Antibody [NBP3-05517] - Staining of human colon shows low expression as expected.
Immunohistochemistry-Paraffin: Kallikrein 8/Neuropsin Antibody [NBP3-05517]

Immunohistochemistry-Paraffin: Kallikrein 8/Neuropsin Antibody [NBP3-05517]

Immunohistochemistry-Paraffin: Kallikrein 8/Neuropsin Antibody [NBP3-05517] - Staining of human esophagus shows high expression.

Applications for Kallikrein 8/Neuropsin Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Kallikrein 8/Neuropsin

Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Alternate splicing of this gene results in four transcript variants encoding four different isoforms. The isoforms exhibit distinct patterns of expression that suggest roles in brain plasticity and ovarian cancer.

Alternate Names

KLK8, Neuropsin, Ovasin, PRSS19

Gene Symbol

KLK8

Additional Kallikrein 8/Neuropsin Products

Product Documents for Kallikrein 8/Neuropsin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Kallikrein 8/Neuropsin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Kallikrein 8/Neuropsin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Kallikrein 8/Neuropsin Antibody - BSA Free and earn rewards!

Have you used Kallikrein 8/Neuropsin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies