KAT1 Antibody (7U2O3)

Novus Biologicals | Catalog # NBP3-16412

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 7U2O3 expressed in HEK293
View all KAT1 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 200-400 of human KAT1 (NP_003633.2). HYFLVFEKYNKDGATLFATVGYMTVYNYYVYPDKTRPRVSQMLILTPFQGQGHGAQLLETVHRYYTEFPTVLDITAEDPSKSYVKLRDFVLVKLCQDLPCFSREKLMQGFNEDMVIEAQQKFKINKQHARRVYEILRLLVTDMSDAEQYRSYRLDIKRRLISPYKKKQRDLAKMRKCLRPEELTNQMNQIEISMQHEQLEE

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for KAT1 Antibody (7U2O3)

Western Blot: KAT1 Antibody (7U2O3) [NBP3-16412]

Western Blot: KAT1 Antibody (7U2O3) [NBP3-16412]

Western Blot: KAT1 Antibody (7U2O3) [NBP3-16412] - Western blot analysis of extracts of various cell lines, using KAT1 Rabbit mAb (NBP3-16412) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Immunocytochemistry/ Immunofluorescence: KAT1 Antibody (7U2O3) [NBP3-16412]

Immunocytochemistry/ Immunofluorescence: KAT1 Antibody (7U2O3) [NBP3-16412]

Immunocytochemistry/Immunofluorescence: KAT1 Antibody (7U2O3) [NBP3-16412] - Immunofluorescence analysis of NIH-3T3 cells using KAT1 Rabbit mAb (NBP3-16412) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: KAT1 Antibody (7U2O3) [NBP3-16412]

Immunocytochemistry/ Immunofluorescence: KAT1 Antibody (7U2O3) [NBP3-16412]

Immunocytochemistry/Immunofluorescence: KAT1 Antibody (7U2O3) [NBP3-16412] - Immunofluorescence analysis of C6 cells using KAT1 Rabbit mAb (NBP3-16412) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
KAT1 Antibody (7U2O3)

Immunohistochemistry: KAT1 Antibody (7U2O3) [NBP3-16412] -

Immunohistochemistry: KAT1 Antibody (7U2O3) [NBP3-16412] - Immunohistochemistry analysis of KAT1 in paraffin-embedded human colon tissue using KAT1 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
KAT1 Antibody (7U2O3)

Immunohistochemistry: KAT1 Antibody (7U2O3) [NBP3-16412] -

Immunohistochemistry: KAT1 Antibody (7U2O3) [NBP3-16412] - Immunohistochemistry analysis of KAT1 in paraffin-embedded human cervix cancer tissue using KAT1 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
KAT1 Antibody (7U2O3)

Immunohistochemistry: KAT1 Antibody (7U2O3) [NBP3-16412] -

Immunohistochemistry: KAT1 Antibody (7U2O3) [NBP3-16412] - Immunohistochemistry analysis of KAT1 in paraffin-embedded rat colon tissue using KAT1 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
KAT1 Antibody (7U2O3)

Immunohistochemistry: KAT1 Antibody (7U2O3) [NBP3-16412] -

Immunohistochemistry: KAT1 Antibody (7U2O3) [NBP3-16412] - Immunohistochemistry analysis of KAT1 in paraffin-embedded mouse testis tissue using KAT1 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Applications for KAT1 Antibody (7U2O3)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: KAT1

In the intact cell, DNA closely associates with histones and other nuclear proteins to form chromatin. The remodeling of chromatin is believed to be a critical component of transcriptional regulation and a major source of this remodeling is brought about by the acetylation of nucleosomal histones. Acetylation of lysine residues in the amino terminal tail domain of histone results in an allosteric change in the nucleosomal conformation and an increased accessibility to transcription factors by DNA. Conversely, the deacetylation of histones is associated with transcriptional silencing. Several mammalian proteins have been identified as nuclear histone acetylases, including GCN5, PCAF (p300/CBPassociated factor), p300/CBP, HAT1, and the TFIID subunit TAF II p250. Mammalian HDAC1 (also designated HD1), HDAC2 (also designated RPD3) and HDAC3-6, have been identified as histone deacetylases.

Alternate Names

EC 2.3.1.48, histone acetyltransferase 1, histone acetyltransferase type B catalytic subunit, KAT1

Gene Symbol

HAT1

Additional KAT1 Products

Product Documents for KAT1 Antibody (7U2O3)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for KAT1 Antibody (7U2O3)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for KAT1 Antibody (7U2O3)

There are currently no reviews for this product. Be the first to review KAT1 Antibody (7U2O3) and earn rewards!

Have you used KAT1 Antibody (7U2O3)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies