Kv12.2 Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-14142
![Immunocytochemistry/ Immunofluorescence: Kv12.2 Antibody [NBP2-14142]](https://resources.rndsystems.com/images/products/Kv12.2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-14142-img0003.jpg "Immunocytochemistry/ Immunofluorescence: Kv12.2 Antibody [NBP2-14142]")
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Predicted:
Mouse (96%), Rat (95%). Backed by our 100% Guarantee.
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: EVDTSSLSGDNTLMSTLEEKETDGEQGPTVSPAPADEPSSPLLSPGCTSSSSAAKLLSPRRTAPRPRLGGRGRPGRAGALK
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Kv12.2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: Kv12.2 Antibody [NBP2-14142]
Immunocytochemistry/Immunofluorescence: Kv12.2 Antibody [NBP2-14142] - Staining of human cell line A549 shows localization to nucleus & mitochondria. Antibody staining is shown in green.![Immunohistochemistry-Paraffin: Kv12.2 Antibody [NBP2-14142]](https://resources.rndsystems.com/images/products/Kv12.2-Antibody-Immunohistochemistry-Paraffin-NBP2-14142-img0002.jpg "Immunohistochemistry-Paraffin: Kv12.2 Antibody [NBP2-14142]")
Immunohistochemistry-Paraffin: Kv12.2 Antibody [NBP2-14142]
Immunohistochemistry-Paraffin: Kv12.2 Antibody [NBP2-14142] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.Applications for Kv12.2 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:500 - 1:1000
Immunohistochemistry-Paraffin
1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Kv12.2
Alternate Names
BEC1, brain-specific eag-like channel 1, ELK channel 2, ELK2, ether-a-go-go K(+) channel family member, ether-a-go-go-like potassium channel 2, KIAA1282, Kv12.2, potassium voltage-gated channel subfamily H member 3, potassium voltage-gated channel, subfamily H (eag-related), member 3, voltage-gated potassium channel subunit Kv12.2
Gene Symbol
KCNH3
Additional Kv12.2 Products
Product Documents for Kv12.2 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Kv12.2 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for Kv12.2 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review Kv12.2 Antibody - BSA Free and earn rewards!
Have you used Kv12.2 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
FAQs for Kv12.2 Antibody - BSA Free
Showing
1
-
1 的
1 FAQ
Showing All
-
Q: I am interested in your Kv12.2 antibody, but I see on your website that the only image is IHC of human kidney (and this was using NBP2-14142). I was wondering whether you have any images using brain tissue/brain lysate, as well as any images using NBP1-30641, as I am also interesting in running westerns with the antibody. Additionally, do you have a control peptide and Kv12.2 over-expressing lysate for the antibody?
A: NBP1-14142 has only been validated in IHC on paraffin-embedded tissues and has not been tested for its use in Western blot. NBP1-30641 has been validated in Western blot and IHC on both frozen and paraffin-embedded tissues. We do not currently have any images for this but this product is 100% guaranteed for the applications and species listed on the datasheet. We do not currently have a positive control lysate for this target.
Loading...